SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004823 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004823
Domain Number 1 Region: 39-301
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000000165
Family Rhodopsin-like 0.024
Further Details:      
 
Domain Number 2 Region: 1-36
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.00000196
Family Hormone receptor domain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004823   Gene: ENSGGOG00000004920   Transcript: ENSGGOT00000004946
Sequence length 334
Comment pep:novel chromosome:gorGor3.1:7:31053239:31067127:1 gene:ENSGGOG00000004920 transcript:ENSGGOT00000004946 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NAYRECLENGMWASKINYSQCEPILDDKQRKYDLHYRVALVVNYLGHCISVAALVAAFLL
FLALRSIRCLRNVIHWNLITTFILRNVTWFLLQLVDHEVHESNEVWCRCITTIFNYFVVT
NFFWMFVEGCYLHTAIVMTYSTERLRKCLFLFIGWCIPFPIIVAWAIGKLYYENEQCWFG
KEPGDLVDYIYQGPIILVLLINFVFLFNIVRILMTKLRASTTSETIQYRKAVKATLVLLP
LLGITYMLFFVNPGEDDQSQIVFIYFNSFLQSFQGFFVSVFYCFFNGEVRSAVRKRWHHW
QDHHSLRVPVARAMSIPTSPTRISFHSIKQTAAV
Download sequence
Identical sequences ENSGGOP00000004823 ENSGGOP00000004823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]