SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000004917 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000004917
Domain Number 1 Region: 173-558
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.97e-157
Family Myotubularin-like phosphatases 0.000000000011
Further Details:      
 
Domain Number 2 Region: 50-171
Classification Level Classification E-value
Superfamily PH domain-like 5.41e-41
Family GRAM domain 0.0000157
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000004917   Gene: ENSGGOG00000005018   Transcript: ENSGGOT00000005044
Sequence length 617
Comment pep:novel chromosome:gorGor3.1:X:148561589:148634853:1 gene:ENSGGOG00000005018 transcript:ENSGGOT00000005044 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPTGSHVEWCKQLIAATISSQISGSVTSENVSRDYKALRDGNKLAQMEEAPLFPGESIKA
IVKDVMYICPFMGAVSGTLTVTDFKLYFKNVERDPHFILDVPLGVISRVEKIGAQSHGDN
SCGIEIVCKDMRNLRLAYKQEEQSKLGIFENLNKHAFPLSNGQALFAFSYKEKFPINGWK
VYDPVSEYKRQGLPNESWKISKINSNYEFCDTYPAIIVVPTSVKDDDLSKVAAFRAKGRV
PVLSWIHPESQATITRCSQPLVGPNDKRCKEDEKYLQTIMDANAQSHKLIIFDARQNSVA
DTNKTKGGGYESESAYPNAELVFLEIHNIHVMRESLRKLKEIVYPSIDEARWLSNVDGTH
WLEYIRMLLAGAVRIADKIESGKTSVVVHCSDGWDRTAQLTSLAMLMLDSYYRTIKGFET
LVEKEWISFGHRFALRVGHGNDNHADADRSPIFLQFIDCVWQMTRQFPSAFEFNELFLIT
ILDHLYSCLFGTFLCNCEQQRFKEDVYTKTISLWSYINSQLDEFSNPFFVNYENHVLYPV
ASLSHLELWVNYYVRWNPRMRPQMPIHQNLKELLAVRAELQKRVEGLQREVATRAISSSS
ERGSSPSHSATSVHTSV
Download sequence
Identical sequences ENSGGOP00000004917 ENSGGOP00000004917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]