SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005140 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005140
Domain Number 1 Region: 261-559
Classification Level Classification E-value
Superfamily DNase I-like 3.4e-25
Family DNase I-like 0.027
Further Details:      
 
Domain Number 2 Region: 36-104
Classification Level Classification E-value
Superfamily RuvA domain 2-like 3.71e-22
Family ComEA-like 0.017
Further Details:      
 
Domain Number 3 Region: 134-195
Classification Level Classification E-value
Superfamily RuvA domain 2-like 2.45e-18
Family ComEA-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005140   Gene: ENSGGOG00000005247   Transcript: ENSGGOT00000005274
Sequence length 569
Comment pep:novel chromosome:gorGor3.1:7:36803392:36949666:1 gene:ENSGGOG00000005247 transcript:ENSGGOT00000005274 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSTLGCHRSIPRDPSDLSHSRKFSAACNFSNILVNQERLNINTATEEELMTLPGVTRAV
ARSIVEYREYIGGFKKVEDLALVSGVGATKLEQVKFEICVSSKGSSAQHSPSSLRRDLLA
EQQPHHLATAVPLTPRVNINTATPAQLMSVRGLSEKMALSIVDFRREHGPFRSVEDLVRM
DGINAAFLDRIRHQVFAERSRPPSTHTNGGLTFTAKPHPSPTSLSLQSEDLDLPPGGPTQ
IISTRPSVEAFGGTRDGRPVLRLATWNLQGCSVEKANNPGVREVVCMTLLENSIKLLAVQ
ELLDREALEKFCTELNQPTLPNIRKWKGPRGCWKAVVAEKPSNQLQKGAGYAGFLWDAAA
GMELRDAGSQESSPSNGHGKPAGPSPYLGRFKVGSHDLTLVNLHLAALTLLGSENPSKNH
SDGHRLASFAQTLQETLKGEKDVIILGDFGQGPDSNDYDILRKEKFHHLIPAHTFTNIST
KNPQGSKSLDNIWISKSLKKVFTGHWAVVREGLTNPWIPDNWSWGGVASEHCPVLAELYT
EKDWSKKDAPRNGSGVALERSEANIKHER
Download sequence
Identical sequences G3QR97
ENSGGOP00000005140 ENSGGOP00000005140 XP_003815012.1.60992 XP_004045357.1.27298 ENSPTRP00000032600 ENSPTRP00000032600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]