SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005271 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005271
Domain Number 1 Region: 42-160
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000107
Family Growth factor receptor domain 0.0015
Further Details:      
 
Domain Number 2 Region: 144-196
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000405
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005271   Gene: ENSGGOG00000005382   Transcript: ENSGGOT00000005410
Sequence length 243
Comment pep:novel chromosome:gorGor3.1:8:107282914:107316588:-1 gene:ENSGGOG00000005382 transcript:ENSGGOT00000005410 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQFRLFSFALIILNCMDYSHCQGNRWRRSKRASYVSNPICKGCLSCSKDNGCSRCQQKLF
FFLRREGMRQYGECLHSCPSGYYGHRAPDMNRCARCRIENCDSCFSKDFCTKCKVGFYLH
RGRCFDECPDGFAPLEETMECVEGCEVGHWSEWGTCSRNNRTCGFKWGLETRTRQIVKKP
AKDTIPCPTIAESRRCKMTMRHCPGGKRTPKAKEKRNKKKKRKLIERAQEQHSVFLATDR
ANQ
Download sequence
Identical sequences G1QVK2
ENSGGOP00000022969 ENSNLEP00000004973 XP_003256151.1.23891 XP_004047478.1.27298 XP_012362301.1.23891 ENSNLEP00000004973 ENSGGOP00000005271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]