SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005366 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005366
Domain Number 1 Region: 120-195
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 3.14e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005366   Gene: ENSGGOG00000005479   Transcript: ENSGGOT00000005507
Sequence length 234
Comment pep:novel chromosome:gorGor3.1:12:102277529:102278233:1 gene:ENSGGOG00000005479 transcript:ENSGGOT00000005507 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESSAKMESGVAGQQPQPQPQQPFLPPAACFFATAAAAAAAAAAAAAQSAQQQQQQQQQQ
APQLRPAADGQPSGGGHKSAPKQVKRQRSSSPELMRCKRRLNFSGFGYSLPQQQPAAVAR
RNERERNRVKLVNLGFATLREHVPNGAANKKMSKVETLRSAVEYIRALQQLLDEHDAVSA
AFQAGVLSPTISPNYSNDLNSMAGSPVSSYSSDEGSYDPLSPEEQELLDFTNWF
Download sequence
Identical sequences ENSGGOP00000005366 ENSGGOP00000025408

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]