SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005450 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005450
Domain Number 1 Region: 390-548,628-759
Classification Level Classification E-value
Superfamily L domain-like 9.3e-57
Family Ngr ectodomain-like 0.00077
Further Details:      
 
Domain Number 2 Region: 1018-1207
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.98e-44
Family Laminin G-like module 0.0029
Further Details:      
 
Domain Number 3 Region: 159-318
Classification Level Classification E-value
Superfamily L domain-like 8.5e-37
Family Ngr ectodomain-like 0.0083
Further Details:      
 
Domain Number 4 Region: 2-124
Classification Level Classification E-value
Superfamily L domain-like 1.02e-30
Family Ngr ectodomain-like 0.0025
Further Details:      
 
Domain Number 5 Region: 861-988
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000549
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 6 Region: 829-873
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000575
Family EGF-type module 0.012
Further Details:      
 
Domain Number 7 Region: 1205-1243
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000252
Family EGF-type module 0.033
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000005450
Domain Number - Region: 1247-1282
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000203
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 1292-1323
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000318
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 800-830
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0128
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005450   Gene: ENSGGOG00000005553   Transcript: ENSGGOT00000005594
Sequence length 1402
Comment pep:novel chromosome:gorGor3.1:10:110345103:110533035:-1 gene:ENSGGOG00000005553 transcript:ENSGGOT00000005594 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPELLFQNNQALSRLDLSENAIQAIPRKAFRGATDLKNLQLDKNRISCIEEGAFRALRG
LEVLTLNNNNITTIPVSSFNHMPKLRTFRLHSNHLFCDCHLAWLSQWLRQRPTIGLFTQC
SGPASLRGLNVAEVQKSEFSCSGQGEAGRVPTCTLSSGSCPAMCTCSNGIVDCRGKGLTA
IPANLPETMTEIRLELNGIKSIPPGAFSPYRKLRRIDLSNNQIAEIAPDAFQGLRSLNSL
VLYGNKITDLPRGVFGGLYTLQLLLLNANKINCIRPDAFQDLQNLSLLSLYDNKIQSLAK
GTFTSLRAIQTLSLFQTPNSCKATLNFHAHLLDVNNIDFAAVLLAPRDLTFKRPGAVAHT
CFRCSAKEQYFIPGTEDYQLNSECSSDVVCPHKCRCEANVVECSSLKLTKIPERIPQSTA
ELRLNNNEISILEATGMFKKLTHLKKINLSNNKVSEIEDGAFEGAASVSELHLTANQLES
IRSGMFRGLDGLRTLMLRNNRISCIHNDSFTGLRNVRLLSLYDNQITTVSPGAFDTLQSL
STLNLLANPFNCNCQLAWLGGWLRKRKIVTGNPRCQNPDFLRQIPLQDVAFPDFRCEEGQ
EEGSCLPRPQCPQECACLDTVVRCSNKHLRALPKGIPKNVTELYLDGNQFTLVPGQLSTF
KYLQLVDLSNNKISSLSNSSFTNMSQLTTLILSYNALRCIPPLAFQGLRSLRLLSLHGND
ISTLQEGIFADVTSLSHLAIGANPLYCDCHLRWLSSWVKTGYKEPGIARCAGPQDMEGKL
LLTTPAKKFECQGPPTLAVQAKCDPCLSSPCQNQGTCHNDPLEEQGRDCEVSLDSCSSGP
CENGGTCHAQEGEDVPFTCSCPTGFEGPTCGVNTDDCVDHACANGGICVDGVGNYTCQCP
LQYEGKACEQLVDLCSPDLNPCQHEAQCVSTPDGPRCECMPGYAGDNCSENQDDCRDHRC
QNGAQCMDEVNSYSCLCAEGYSGQLCEIPPHLPAPKSPCEGTECQNGANCVDQGNRPVCQ
CLPGFGGPECEKLLSVNFVDRDTYLQFTDLQNWPRANITLQVSTAEDNGILLYNGDNDHI
AVELYQGHVRVSYDPGSYPSSAIYSAETINDGQFHTVELVAFDQMVNLSIDGGSPMTMDN
FGKHYTLNSEAPLYVGGMPVDVNSAAFRLWQILNGTGFHGCIRNLYINNELQDFTKTQMK
PGVVPGCEPCRKLYCLHGICQPNATPGPMCHCESGWVGLHCDQPADGPCHGHKCVHGQCV
PLDALSYSCQCQDGYSGALCNQAGALAEPCRGLQCLHGHCQASGTKGAHCVCDPGFSGEL
CEQESECRGDPVRDFHQVQRGYAICQTTRPLSWVECQGSCPGQGCCQGLRLKRRKFTFEC
SDGTSFAEEVEKPTKCGCALCA
Download sequence
Identical sequences ENSGGOP00000005450 ENSGGOP00000005450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]