SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005560 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005560
Domain Number 1 Region: 80-152
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000017
Family HLH, helix-loop-helix DNA-binding domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005560   Gene: ENSGGOG00000005683   Transcript: ENSGGOT00000005705
Sequence length 389
Comment pep:novel chromosome:gorGor3.1:15:69579351:69581343:1 gene:ENSGGOG00000005683 transcript:ENSGGOT00000005705 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQSPPPQSLLGHDHYIFAQGWGWAGHWDSTSPASSSDSSGSCPCDGARGLPQPAPPSCS
SRAAEAAATTPRRARTGPAGGQRQSASEREKLRMRTLARALHELRRFLPPSLAPAGQSLT
KIETLRLAIRYIGHLSAVLGLSEESLQCRRRQRGDAGSPWGCPLCPDRGPAEAQTQAEGQ
GQGQGQGQGRGQGQGQGRRPRLVSAVLAEASWGSPSACPGAQAAPERLGRGVHDTDPWAT
PPYCPKIQSPPYSSQGTTSDASLWTPPQGCPWTQSSPEPRNPPVPWTTAPATLELAAVYQ
GLSVSPEPCLSLGAPSLLPHPSCQRLQPQTPWGCWSHSAEVVPNSEDQGPGATFQLSEAS
PAQSSGLRFSGCPELWQEDLEGARLGIFY
Download sequence
Identical sequences G3S5R3
ENSGGOP00000023419 ENSGGOP00000005560 XP_018866045.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]