SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006038 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006038
Domain Number 1 Region: 78-236
Classification Level Classification E-value
Superfamily E set domains 3.22e-54
Family RhoGDI-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006038   Gene: ENSGGOG00000009690   Transcript: ENSGGOT00000006200
Sequence length 240
Comment pep:novel chromosome:gorGor3.1:5:55802779:55808615:1 gene:ENSGGOG00000009690 transcript:ENSGGOT00000006200 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVKKGGGGAGTGTEPAPGPSGPSVAPIPQPPAESESGSESEPDAGPGPRPGPLQRKQPI
XXXXXXXXCLFPLDYLCSPEENIYKIDFVRFKIRDMDSGTVLFEIKKPPVSERLPINRRD
LDPNAGRFVRYQFTPAFLRLRQVGATVEFTVGDKPVNNFRMIERHYFRNQLLKSFDFHFG
FCIPSSKNTCEHIYDFPPLSEELISEMIRHPYETQSDSFYFVDDRLVMHNKADYSYSGTP
Download sequence
Identical sequences ENSGGOP00000006038 ENSGGOP00000006038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]