SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006067 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006067
Domain Number 1 Region: 65-144
Classification Level Classification E-value
Superfamily HSP20-like chaperones 0.000000000000732
Family HSP20 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006067   Gene: ENSGGOG00000006205   Transcript: ENSGGOT00000006229
Sequence length 150
Comment pep:novel chromosome:gorGor3.1:17:42772522:42773284:-1 gene:ENSGGOG00000006205 transcript:ENSGGOT00000006229 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKIILRHLIEIPVRYQEEFEARGLEDCRLDHALYALPGPTIVDLRKTRAAQSPPVDSAA
ETPPREGKSHFQILLDVVQFLPEDIIIQTFEGWLLIKAQHGTRMDEHGFISRSFTRQYKL
PDGVEIKDLSAVLCHDGILVVEVKDPVGTK
Download sequence
Identical sequences G3QTN8 H2QQW1 Q12988 Q6ICS9
ENSGGOP00000006067 9598.ENSPTRP00000028895 9606.ENSP00000303394 ENSP00000303394 ENSPTRP00000028895 ENSP00000303394 gi|5453688|ref|NP_006299.1| ENSGGOP00000006067 ENSP00000303394 ENSPTRP00000028895 GO.99033 HR6360 NP_006299.1.87134 NP_006299.1.92137 XP_004058909.1.27298 XP_517764.2.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]