SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006310 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006310
Domain Number 1 Region: 1152-1307,1347-1426
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.63e-42
Family Voltage-gated potassium channels 0.02
Further Details:      
 
Domain Number 2 Region: 1476-1727
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.33e-36
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Domain Number 3 Region: 129-271,335-404
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.65e-29
Family Voltage-gated potassium channels 0.018
Further Details:      
 
Domain Number 4 Region: 666-895
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.28e-29
Family Voltage-gated potassium channels 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006310   Gene: ENSGGOG00000006446   Transcript: ENSGGOT00000006479
Sequence length 1957
Comment pep:novel chromosome:gorGor3.1:3:39759540:39857735:-1 gene:ENSGGOG00000006446 transcript:ENSGGOT00000006479 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFTIGSLETNNFRRFTPESLVEIEKQIAAKQGTKKAREKHREQKDQEEKPRPQLDLKAC
NQLPKFYGELPAELIGEPLEDLDPFYSTHRTFMVLNKGRTISRFSATRALWLFSPFNLIR
RTAIKVSVHSWFSLFITVTILVNCVCMTRTDLPEKIEYVFTVIYTFEALIKILARGFCLN
EFTYLRDPWNWLDFSVITLAYVGTAIDLRGISGLRTFRVLRALKTVSVIPGLKVIVGALI
HSVKKLADVTILTIFCLSVFALVGLQLFKGNLKNKCVKNDMAVNETTNYSSHRKPDIYIN
KRGTSDPLLCGNGSDSGHCPDGYICLKTSDNPDFNYTSFDSFAWAFLSLFRLMTQDSWER
LYQQTLRASGKIYMIFFVLVIFLGSFYLVNLILAVVTMAYEEQNQATTDEIEAKEKKFQE
ALEMLRKEQEVLAALGIDTTSLHSHNGSPLTSKNASERRHRIKPRVSEGSTEDNKSPLSD
PYNQGNAQSFLGLASGKRRASHGSVFHFRSPGRDISLPEGVTDDGVFPGDHESHRGSLLL
GGGAGQQGPLPRSPLPQPSNPDFRHGEGEHQPPPTSELAPGAVDVSAFDAGQKKTFLSAE
YLDEPFRAQRAMSVVSIITSVLEELEESEQKCPPCLTSLAQKYLIWDCCPMWVKLKTILF
GLVTDPFAELTITLCIVVNTIFMAMEHHGMSPTFEAMLQIGNIVFTIFFTAEMVFKIIAF
DPYYYFQKKWNIFDCIIVTVSLLELGLAKKGSLSVLRSFRLLRVFKLAKSWPTLNTLIKI
IGNSVGALGNLTIILAIIVFVFALVGKQLLGENYRNNRKNISAPHEDWPRWHMHDFFHSF
LIVFRILCGEWIENMWACMEVGQKSICLILFLTVMVLGNLVVLNLFIALLLNSFSADNLT
APEDDGEVNNLQVALARIQVFGHRTKQSLCTFFSRPCPFSQPKAEPELVVKLPLSSSKAE
NHVAANTARGSSGGLQAPRGPRDEHSDFIANPTVWVSVPIAEGESDLDDLEDDGGEDAQS
FQQEVIPKGQQEQLQQVEGCGDHLTPRSPGTGTSSEDLAPSLGETRKDESVPQAPAEGVD
DTSSSEGSTVDCPDPEEILRKIPELADDLEEPDDCFTEGCIRHCPCCKVDTTKSPWDVGW
QVRKTCYRIVEHSWFESFIIFMILLSSGSLAFEDYYLDQKPTVKALLEYTDRVFTFIFVF
EMLLKWVAYGFRKYFTNAWCWLDFLIVNISLISLTAKILEYSEVAPIKALRTLRALRPLR
ALSRFEGMRVVVDALVGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFWRCINYTDGEYS
LVPLSIVNNKSDCKIQNSTGSFFWVNVKVNFDNVAMGYLALLQVATFKGWMDIMYAAVDS
REVNMQPKWEDNVYMYLYFVIFIIFGGFFTLNLFVGVIIDNFNQQKKKLGGQDIFMTEEQ
KKYYNAMKKLGSKKPQKPIPRPLNKFQGFVFDIVTRQAFDITIMVLICLNMITMMVETDD
QSEEKTKILGKINQFFVAVFTGECVMKMFALRQYYFTNGWNVFDFIVVVLSIASLIFSAI
LKSLQSYFSPTLFRVIRLARIGRILRLIRAAKGIRTLLFALMMSLPALFNIGLLLFLVMF
IYSIFGMSSFPHVRWEAGIDDMFNFQTFANSMLCLFQITTSAGWDGLLSPILNTGPPYCD
PNLPNSNGTRGDCGSPAVGIIFFTTYIIISFLIVVNMYIAVILENFNVATEESTEPLSED
DFDMFYETWEKFDPEATQFITFSALSDFADTLSGPLRIPKPNRNTLIQMDLPLVPGDKIH
CLDILFAFTKNVLGESGELDSLKANMEEKFMATNLSKSSYEPIATTLRWKQEDISATVIQ
KAYRSYVLHRSMALSNTPCVPRAEEEAASLQDEGFVAFTANENCVLPDKSETASATSFPP
SYESVTRGLSDRVNMRTSSSIQNEDEATSMEVIAPGP
Download sequence
Identical sequences ENSGGOP00000006310 ENSGGOP00000006310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]