SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006315 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006315
Domain Number 1 Region: 1-52
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.22e-21
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 2 Region: 312-368
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.25e-19
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 3 Region: 358-415
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.46e-16
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006315   Gene: ENSGGOG00000006459   Transcript: ENSGGOT00000006484
Sequence length 417
Comment pep:novel chromosome:gorGor3.1:19:45548636:45556222:1 gene:ENSGGOG00000006459 transcript:ENSGGOT00000006484 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQDLVTFADVAVNFTKEEWTLLDPAQRNLYRDVMLENSRNLAFIDWATPCKTKDATPQP
DILPKRTFPEANRVCLTSISSQHSTLREDWRCPKTEEPHRQGVNNVKPPAVAPEKNESPV
SICEDHEMRNHSKPTCRLVPSQGDSIRQCILTRDSSIFKYNPVLNDSQKTHENNEHDGVL
GRNIQWVPCGRKTELKSSTWTGSQNTVHHIRDEIDMGANRHQRNPFGKAFREDGSLRAHN
TRGQEKMYDFTQCENTSRNNSIHAVQVQLYTAETNKKDCQTGATSANAPNSGSHKSHCTG
EKTHKCPECGRAFFYQSFLMRHMKIHTGEKPYECGKCGKAFRYSLHLNKHLRKHVVQKKP
YECEECGKVIRESSKYTHIRSHTGEKPYKCKTCGKDFAKSSGLKKHLKTHKDEKPCE
Download sequence
Identical sequences ENSGGOP00000006315 ENSGGOP00000006315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]