SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006515 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006515
Domain Number 1 Region: 539-715
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.95e-51
Family G proteins 0.0000152
Further Details:      
 
Domain Number 2 Region: 43-75
Classification Level Classification E-value
Superfamily EF-hand 0.0000547
Family S100 proteins 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006515   Gene: ENSGGOG00000006651   Transcript: ENSGGOT00000006686
Sequence length 740
Comment pep:novel chromosome:gorGor3.1:9:64869980:64956869:-1 gene:ENSGGOG00000006651 transcript:ENSGGOT00000006686 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEADGDGEELARLRSVFAXXXXXXXXXXXXXXXXXXXXXXXXRPADAEAVFQRLDADRDG
AITFQEFARGFLGALRGGRRRDWGPLDPAPAVSEAGPETYDSEEDEGDEDAAAALATSWG
PASPGRAWQDFQARLGDEAKFIPREEQVSTLYQNINLVEPRLIQPYEHVIKNFIREIRLQ
STEMENLAIAVKRAQDKAAMQLSELEEEMDQRIQAAEHKTRKDEKRKAEEALSDLRRQYE
TEVGDLQVTIKKLRKLEEQSKRVSQKEDVAALKKQIYDLSMENQKVKKDLLEAQTNIAFL
QSELDALKSDYADQSLNTERDLQIIREYTEDRNSLERQIEILQTANRKLHDSNDGLRSAL
ENSYSKFNRSLHINNISPGNTISRSSPKFIGHSPQPLGYDRSSRSSYVDEDCDSLALCDP
LQRTSCEVDSLPESCFDSGLSTLRDPNEYDSEVEYKHQRGFQRSHGVQESFGGDASDTDV
PDIRDEETFGLEDVASVLDWKPQGSVSEGSIVSSSRKPISALSPQTDLVDDNAKSFSSQK
AYKIVLAGDAAVGKSSFLMRLCKNEFRENISATLGVDFQMKTLIVDGERTVLQLWDTAGQ
ERFRSIAKSYFRKADGVLLLYDVTCEKSFLNIREWVDMIEDAAHETVPIMLVGNKADIRD
TAATEGQKCVPGHFGEKLAMTYGALFCETSAKDGSNIVEAVLHLAREVKKRTDKDDSRSI
TNLTGTNSKKSPQMKNCCNG
Download sequence
Identical sequences ENSGGOP00000006515 ENSGGOP00000006515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]