SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006533 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006533
Domain Number 1 Region: 39-136
Classification Level Classification E-value
Superfamily Cystatin/monellin 2.13e-18
Family Cathelicidin motif 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006533   Gene: ENSGGOG00000006676   Transcript: ENSGGOT00000006704
Sequence length 211
Comment pep:novel chromosome:gorGor3.1:2b:123318168:123344609:1 gene:ENSGGOG00000006676 transcript:ENSGGOT00000006704 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MISRMEKMTMMMKILIMFALGMNYWSCSGFPVYDYDPSSLRDALSASVAKVNSQSLSPYL
FRAFRSSLKRVEVLDENNLVMNLEFSIRETTCRKDSGEDPATCAFQRDYYVSTAVCRSTV
KVSAQQVQGVHARCSWSSSTSESYSSEEMIFGDMLGSHKWRNNYLFGLISDESISEQFYD
RSLGIMRRVLPPGNRRYPNHRHRARINTDFE
Download sequence
Identical sequences G3QUX2
ENSGGOP00000006533 XP_004033443.1.27298 ENSGGOP00000006533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]