SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006633 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006633
Domain Number 1 Region: 3-76
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 4.97e-19
Family HLH, helix-loop-helix DNA-binding domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006633   Gene: ENSGGOG00000006780   Transcript: ENSGGOT00000006806
Sequence length 108
Comment pep:novel chromosome:gorGor3.1:9:87805800:87806188:1 gene:ENSGGOG00000006780 transcript:ENSGGOT00000006806 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRKIFTNTRERWRQQNVNSAFAKLRKLIPTHPPDKKLSKNETLRLAMRYINFLVKVLGE
QSLQQTGVAAQGNILGLFPQGPHLPGLEDRTLLENYQVPSPGPSHHIP
Download sequence
Identical sequences G1SBD4 G3QV69 H2QXM9 Q16559
ENSGGOP00000006633 ENSPTRP00000036263 ENSP00000334547 ENSNLEP00000022828 ENSPTRP00000036263 HR6460 gi|4885619|ref|NP_005412.1| 9598.ENSPTRP00000036263 9606.ENSP00000334547 NP_005412.1.87134 NP_005412.1.92137 XP_003260366.1.23891 XP_003809282.1.60992 XP_004048448.1.27298 XP_016816868.1.37143 ENSP00000334547 ENSNLEP00000022828 ENSGGOP00000006633 ENSP00000334547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]