SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006923 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006923
Domain Number 1 Region: 43-289,323-414
Classification Level Classification E-value
Superfamily SAICAR synthase-like 1.84e-172
Family Phosphatidylinositol phosphate kinase IIbeta, PIPK IIbeta 0.0000000003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006923   Gene: ENSGGOG00000007073   Transcript: ENSGGOT00000007108
Sequence length 416
Comment pep:novel chromosome:gorGor3.1:5:45377356:45414473:1 gene:ENSGGOG00000007073 transcript:ENSGGOT00000007108 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSNCTSTTAVAVAPLSASKTKTKKKHFVCQKVKLFRASEPILSVLMWGVNHTINELSNV
PVPVMLMPDDFKAYSKIKVDNHLFNKENLPSRFKFKEYCPMVFRNLRERFGIDDQDYQNS
VTRSAPINSDSQGRCGTRFLTTYDRRFVIKTVSSEDVAEMHNILKKYHQFIVECHGNTLL
PQFLGMYRLTVDGVETYMVVTRNVFSHRLTVHRKYDLKGSTVAREASDKEKAKDLPTFKD
NDFLNEGQKLHVGEESKKNFLEKLKRDVEFLAQLKIMDYSLLVGIHDVDRAEQEEMEVEE
RAEDEECENDGVGGNLLCSYGTPPDSPGNLLSFPRFFGPGEFDPSVDVYAMKSHESSPKK
EVYFMAIIDILTPYDTKKKAAHAAKTVKHGAGAEISTVNPEQYSKRFNEFMSNILT
Download sequence
Identical sequences A0A096P575 A0A2K5CVY9 A0A2K5LEX6 A0A2K5RF44 A0A2K5U4S3 A0A2K6KP41 A0A2K6PZI8 F7FTM0 G1QIG5 G3QVY5 H2NUC1 H2QCT4 H9Z3G1 P78356
ENSPANP00000020500 ENSNLEP00000000708 ENSP00000269554 ENSCJAP00000014687 ENSGGOP00000006923 ENSPTRP00000015468 1bo1_A 1bo1_B 1bo1A ENSPPYP00000009556 ENSPTRP00000015467 NP_003550.1.87134 NP_003550.1.92137 XP_001172842.1.37143 XP_002748550.1.60252 XP_002827711.1.23681 XP_003278256.1.23891 XP_003809891.1.60992 XP_004041883.1.27298 XP_005584038.1.63531 XP_008011094.1.81039 XP_010377638.1.97406 XP_011901784.1.92194 XP_014974989.1.72884 XP_017352720.1.71028 XP_017734490.1.44346 XP_021526230.1.9421 ENSP00000480776 ENSP00000482548 gi|4505819|ref|NP_003550.1| ENSNLEP00000000708 ENSCJAP00000015284 ENSP00000269554 ENSGGOP00000006923 9598.ENSPTRP00000015468 9600.ENSPPYP00000009556 9606.ENSP00000269554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]