SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007162 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007162
Domain Number 1 Region: 24-225
Classification Level Classification E-value
Superfamily L domain-like 1.6e-35
Family Ngr ectodomain-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007162   Gene: ENSGGOG00000007321   Transcript: ENSGGOT00000007352
Sequence length 313
Comment pep:novel chromosome:gorGor3.1:1:144695926:144722654:1 gene:ENSGGOG00000007321 transcript:ENSGGOT00000007352 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLASGPGPGWLLFSFGMGLVSGSKCPNNCLCQAQEVICTGKQLTEYPLDIPLNTRRLFL
NENRITSLPAMHLGLLSDLVYLDCQNNRIREVMDYTFIGVFKLIYLDLSSNNLTSISPFT
FSVLSNLVQLNIANNPHLLSLHKFTFANTTSLRYLDLRNTGLQTLDSAALYHLTTLETLF
LSGNPWKCNCSFLDFAIFLIVFHMDPSDDLNATCVEPTELTGWPITRVGNPLRYMCITHL
DHKDYIFLLLIGFCIFAAGTVAAWLTGVCAVLYQNTRHKSSEEDEDEAGTRVEVSRRIFQ
TQTSSVQEFPQLI
Download sequence
Identical sequences G3QWK2 Q8N7C0
NP_001005214.2.87134 NP_001005214.2.92137 XP_004027872.1.27298 XP_018881640.1.27298 ENSGGOP00000007162 ENSGGOP00000007162 ENSP00000294818 ENSP00000294818 ENSP00000294818 9606.ENSP00000294818 gi|194018474|ref|NP_001005214.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]