SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007211 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007211
Domain Number 1 Region: 2-198
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.02e-31
Family Voltage-gated potassium channels 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007211   Gene: ENSGGOG00000007364   Transcript: ENSGGOT00000007402
Sequence length 570
Comment pep:novel chromosome:gorGor3.1:1:42269201:42291435:1 gene:ENSGGOG00000007364 transcript:ENSGGOT00000007402 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLLVFSCLVLSVLSTIQEHQELANECLLILEFVMIVVFGLEYIVRVWSAGCCCRYRGWQG
RFRFARKPFCVIGNEXEELRKKSELGLREMGDLYPFPVWKSPTSPRQAQRSELITAWYIG
FLVLIFASFLVYLAEKDANSDFSSYADSLWWGTITLTTIGYGDKTPHTWLGRVLAAGFAL
LGISFFALPAGILGSGFALKVQEQHRQKHFEKRRMPAANLIQAAWRLYSTDMSRAYLTAT
WYYYDSILPSFRELALLFEHVQRARNGGLRPLEVRRAPVPDGAPSRYPPVATCHRPGSTS
FCPGESSRMGIKDRIRMGSSQRRTGPSKQHLAPPTMPTSPSSEQVGEATSPTKVQKSWSF
NDRTRFRASLRLKPRTSAEDAPSEEVAEEKSYQCELTVDDVMPAVKTVIRSVRILKFLVA
KRKFKETLRPYDVKDVIEQYSAGHLDMLGRIKSLQTRVDQIVGRGPGDRKAREKGDKGPS
DAEVVDEISMMGRVVKVEKQVQSIEHKLDLLLGFYSRCLRSGTSASLGAVQVPLFDPDIT
SDYHSPVDHEDISVSAQTLSISRSVSTNMD
Download sequence
Identical sequences ENSGGOP00000021390 ENSGGOP00000007211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]