SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007230 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007230
Domain Number 1 Region: 9-134
Classification Level Classification E-value
Superfamily Hormone receptor domain 1.57e-30
Family Hormone receptor domain 0.00013
Further Details:      
 
Domain Number 2 Region: 120-381
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000000476
Family Rhodopsin-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007230   Gene: ENSGGOG00000007385   Transcript: ENSGGOT00000007421
Sequence length 382
Comment pep:novel chromosome:gorGor3.1:7:157837227:157947506:-1 gene:ENSGGOG00000007385 transcript:ENSGGOT00000007421 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTLLPPALLTCWLLAPVNSIHPECRFHLEIQEEETKCAELLRSQTEKHKACSGVWDNIT
CWRPANVGETVTVPCPKVFSNFYSKAGNISKNCTSDGWSETFPDFVDACGYSDPEDESKI
TFYILVKAIYTLGYSVSLMSLATGSIILCLFRKLHCTRNYIHLNLFLSFILRAISVLVKD
DVLYSSSGTLHCPDQPSSWVGCKLSLVFLQYCIMANFFWLLVEGLYLHTLLVAMLPPRRC
FLAYLLIGWGLPTVCIGAWTVARLYLEDTGCWDTNDHSVPWWVIRIPILISIIVNFVLFI
SIIRILLQKLTSPDVGGNDQSQYKRLAKSTLLLIPLFGVHYMVFAVFPISISSKYQILFE
LCLGSFQGLVVAVLYCFLNSEV
Download sequence
Identical sequences ENSGGOP00000007230 ENSGGOP00000007230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]