SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007246 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000007246
Domain Number - Region: 700-735
Classification Level Classification E-value
Superfamily Delta-sleep-inducing peptide immunoreactive peptide 0.00785
Family Delta-sleep-inducing peptide immunoreactive peptide 0.007
Further Details:      
 
Domain Number - Region: 347-385
Classification Level Classification E-value
Superfamily Leucine zipper domain 0.0557
Family Leucine zipper domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007246   Gene: ENSGGOG00000000027   Transcript: ENSGGOT00000007437
Sequence length 947
Comment pep:novel chromosome:gorGor3.1:6:127946568:128035834:-1 gene:ENSGGOG00000000027 transcript:ENSGGOT00000007437 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQPPTGGAAPATAAASPAAAATEARLHPEGSSRKQQRAQSPARPRDSSLRQTIAATRSP
VGAGTKLNSVRQQQLQQQQQQGNKTGSRTGPPASIRGGGGGAEKATPLAPKGAAPGAVQP
VAGAEAAPAATLAALGGRRPGPPEEPPRELESLPSKLGEPPPLGEGGGGGGEGGGAGGGS
GEREGGAPQPPPPRGWRGKGVRAQQRGGSGGEGASPSPSSSSAGKTPGTGSRNSGSGVAG
GGSGGGGSYWKEGCLQSELIQFHLKKERAAAAAAAAQMHAKNGGGSSSRSSPVSGPPAIC
ETLAVASASPMAAAAEGPQQSAEGSASGGGMQAAAPPSSQPHPQQLQEQEEMQEEMEKLR
EENETLKNEIDELRTEMDEMRDTFFEEDACQLQEMRHELERANKNCRILQYRLRKAERKR
LRYAQTGEIDGELLRSLEQDLKVAKDVSVRLHHELENVEEKRTTTEDENEKLRQQLIEVE
IAKQALQNELEKMKELSLKRRGSKDLPKSEKKAQQTPTEEDNEDLKCQLQFVKEEAALMR
KKMAKIDKEKDRFEHELQKYRSFYGDLDSPLPKGEAGGPPSTREAELKLRLRLVEEEANI
LGRKIVELEVENRGLKAELDDLRGDDFNGSANPLMREQSESLSELRQHLQLVEDETELLR
RNVADLEEQNKRITAELNKYKYKSGGHDSARHHDNAKTEALQEELKAARLQINELSGKVM
QLQYENRVLMSNMQRYDLASHLGIRGSPRDSDAESDAGKKESDDDSRPPHRKREGPIGGE
SDSEEVRNIRCLTPTRSFYPAPGPWPKSFSDRQQMKDIRSEAERLGKTIDRLIADTSTII
TEARIYVANGDLFGLMDEEDDGSRIREHELLYRINAQMKAFRKELQTFIDRLEVPKSADD
RGAEEPISVSQMFQPIILLILILVLFSSLSYTTIFKLVFLFTLFFVL
Download sequence
Identical sequences G3QCT0
ENSGGOP00000000026 XP_004044709.1.27298 ENSGGOP00000007246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]