SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007344 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007344
Domain Number 1 Region: 43-565
Classification Level Classification E-value
Superfamily SNF-like 3.79e-181
Family SNF-like 0.0000353
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007344   Gene: ENSGGOG00000007497   Transcript: ENSGGOT00000007537
Sequence length 621
Comment pep:novel chromosome:gorGor3.1:12:158117:178501:-1 gene:ENSGGOG00000007497 transcript:ENSGGOT00000007537 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPTHHTAMDGKVAVHEHGPPAVSWVPEEGERLDQEDEDQVKDRGQWTNKMEFVLSVAGEI
IGLGNVWRFPYLCYKNGGGAFFIPYFIFFFACGIPVFFLEVALGQYTSQGSVTAWRKICP
LFQGIGLASVVIESYLNVYYIIILAWALFYLFSSFTSELPWTTCNNFWNTEHCMDFLNHS
GAGTVTPSFPLITYFSQSSRRRVLGITSGIHDLGALRWELALCLLLAWVICYFCIWKGVK
STGKVVYFTATFPYLMLVILLIRGVTLPGAYQGIIYYLKPDLFRLKDPQVWMDAGTQIFF
SFAICQGCLTALGSYNKYHNNCYKDCIALCFLNSATSFVAGFVVFSILGFMSQEQGVPIS
EVAESGPGLAFIAFPKAVTMMPLSQLWSCLFFIMLIFLGLDSQFVCVECLVTASIDMFPR
QLRKSGRRELLILTIAVMCYLIGLFLVTEGGMYIFQLFDYYASSGICLLFLSVFEVVCIS
WVYGADRFYDNIEDMIGYRPWPLVKISWLFLTPGLCLATFLFSLSKYTPLKYNNVYVYPP
WGYSIGWFLALSSMVCVPLFVVITLLKTQGPFRKRLRQLITPDSSLPQPKQHPCLDGSAG
RNFGPSPTKEGLIAGEKETHL
Download sequence
Identical sequences ENSGGOP00000007344 ENSGGOP00000007344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]