SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007563 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007563
Domain Number 1 Region: 5-178
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.53e-68
Family Ephrin receptor ligand binding domain 0.00000199
Further Details:      
 
Domain Number 2 Region: 608-903
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.34e-66
Family Protein kinases, catalytic subunit 0.0000000463
Further Details:      
 
Domain Number 3 Region: 905-969
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000000132
Family SAM (sterile alpha motif) domain 0.0011
Further Details:      
 
Domain Number 4 Region: 436-510
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000206
Family Fibronectin type III 0.00041
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000007563
Domain Number - Region: 235-303,344-365
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00298
Family Growth factor receptor domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007563   Gene: ENSGGOG00000007724   Transcript: ENSGGOT00000007765
Sequence length 978
Comment pep:novel chromosome:gorGor3.1:1:38987167:39036239:-1 gene:ENSGGOG00000007724 transcript:ENSGGOT00000007765 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLSLVILLDSKASQAELGWTALPSNGWEEISGVDEHDRPIRTYQVCNVLEPNQDNWLQTG
WISRGRGQRIFVELQFTLRDCSSIPGAAGTCKETFNVYYLETEADLGRKRPRLGGSRPRK
IDTIAADESFTQGDLGERKMKLNTEVREIGPLSRRGFHLAFQDVGACVALVSVRVYYKQC
RATVRGLATFPATAAESAFSTLVEVAGTCVAHSEGEPGSPPRMHCGADGEWLVPVGRCSC
SAGFQERGDICEACPPGFYKVSPRRPLCSPCPEHSRALENASTFCVCQDSYARSPTDPPS
ASCTRDTKSPPGRPSVSRPPECARGTEDAGVPLLPGQRGGAPFCCVCANRGYRVGLSPCI
PAFCDPANVYTFPQYLELTSLNLSIPLLFTFVTYCFQLQVTINLSLTTASPRLFQCLIGL
TANTWAPWEEDEIRRDRVEPQSVSLSWREPIPAGAPGANDTEYEIRYYEKGQSEQTYSMV
KTGAPTVTVTNLKPATRYVFQIRAASLGPSWEAQSFNPSIEVQTLGEAASGSRDQSPAIV
VTVVTISALLVLGSVMSVLAIWRRPCSYGKGGGDAHDEEELYFHFKVPTRRTFLDPQSCG
DPLQAVHLFAKELDAKSVTLERSLGGGRFGELCCGCLQLPGRQELPVAVHTLRDSASDSQ
RLGFLAEALTLGQFDHSHIVRLEGVVTRGSTLMIVTEYMSHGALDGFLRRHEGQLVAGQL
MGLLPGLASAMKYLSEMGYVHRGLAARHVLVSSDLVCKISGFGRGPRDRSEAVYTTMSGR
SPALWAAPETLQFGHFSSASDVWSFGIIMWEVMAFGERPYWDMSGQDVIKAVEDGFRLPP
PRNCPNPLHRLMLDCWQKDPGERPRFSQIHSILSKMVQDPEPPKCAPTTCPRTPTPLADR
AFSTFPSFGSVGAWLEALDLCRYKDSFAAAGYGSLEAVAEMTAQDLVSLGISSAEHREAL
LSGISALQQDSGGGPVPQ
Download sequence
Identical sequences ENSGGOP00000007563 ENSGGOP00000026942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]