SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008036 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008036
Domain Number 1 Region: 108-170
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 7.2e-17
Family HLH, helix-loop-helix DNA-binding domain 0.0000491
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008036   Gene: ENSGGOG00000008222   Transcript: ENSGGOT00000008257
Sequence length 320
Comment pep:known chromosome:gorGor3.1:11:17943512:17945218:1 gene:ENSGGOG00000008222 transcript:ENSGGOT00000008257 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELLSPPLRDVDLTAPDGSLCSFATTDDFYDDPCFDSPDLRFFEDLDPRLMHVGALLKPE
EHSHFPAAVHPAPGAREDEHVRAPSGHHQAGRCLLWACKACKRKTTNADRRKAATMRERR
RLSKVNEAFETLKRCTSSNPNQRLPKVEILRNAIRYIEGLQALLRDQDAAPPGAAAAFYA
PGPLPPGRGGEHYSGDSDASSPRSNCSDGMMDYSGPPSGARRRNCYEGAYYNEAPSEPRP
GKSAAVSSLDCLSSIVERISTESPAAPALLLADVPSESPPRRQEPAAPSEGESSGDPTQS
PDAAPQCPAGANPNLIYQVL
Download sequence
Identical sequences G3S3Y5
ENSGGOP00000022786 ENSGGOP00000008036 XP_004050817.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]