SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008167 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008167
Domain Number 1 Region: 166-329
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.52e-36
Family SPRY domain 0.00079
Further Details:      
 
Domain Number 2 Region: 5-82
Classification Level Classification E-value
Superfamily RING/U-box 1.83e-20
Family RING finger domain, C3HC4 0.0085
Further Details:      
 
Domain Number 3 Region: 86-148
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000124
Family B-box zinc-binding domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008167   Gene: ENSGGOG00000008359   Transcript: ENSGGOT00000008394
Sequence length 331
Comment pep:novel chromosome:gorGor3.1:11:87163893:87171831:1 gene:ENSGGOG00000008359 transcript:ENSGGOT00000008394 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSGILQVLQRALTCPICMNYFIDPVTIDCGHSFCRPCFYLSWQDMAVLAQCSKCKKTIR
QRNLKTDIGLKNMTSTARKASLRQFLSSEEQICGMHRETKKMFCEVDKSLLCWLCSNSQE
HWNHTHCPIEWAAEECREELLKKMQSLWQKACENLRNLYMETTRTRCWKGITLQHARANS
HIFLHGDLRSMNVGCDPQDDPHITAKSECFLLWGTQAFTSGKYYWEVHVGDPWNGVCNNY
WKEKRQNDKTYGEEGIFLLGCVKEDTHCSLFTISPLVVQYVSRPTSRVGLFLDCEGRTMS
FVDVDQISLIYTIPNCSFSPPVWPIFCCSHF
Download sequence
Identical sequences ENSGGOP00000008167 ENSGGOP00000008167

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]