SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008219 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008219
Domain Number 1 Region: 212-461
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.15e-56
Family Voltage-gated potassium channels 0.00051
Further Details:      
 
Domain Number 2 Region: 86-183
Classification Level Classification E-value
Superfamily POZ domain 3.66e-25
Family Tetramerization domain of potassium channels 0.00000744
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008219   Gene: ENSGGOG00000008416   Transcript: ENSGGOT00000008447
Sequence length 511
Comment pep:novel chromosome:gorGor3.1:1:113457891:113459426:-1 gene:ENSGGOG00000008416 transcript:ENSGGOT00000008447 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVCGWKEMEVALVDFDNSDEIQEEPGYATDFDSTSPKGRPGGNSFSNWKILISESTNHE
TAFSKLLGDYADPPGPEPVVLNEGNQRVIINIAGLRFETQLRTLSQFPDTLLGDREKRMQ
FFDSMRNEYFFDRNRPSFDGILYYYQSGGKIRRPANVPIDIFADEISFYELGSEAMDQFR
EDEGFIKDPETLLPTNDIHRQFWLLFEYPESSSAARAVAVVSVLVVVISITIFCLETLPE
FREDRELKVVRDPNLNMSKTVLSQTMFTDPFFMVESTCIVWFTFELVLRFVVCPSKTDFF
RNIMNIIDIISIIPYFATLITELVQETEPSAQQNMSLAILRIIRLVRVFRIFKLSRHSKG
LQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAGVDEPESHFSSIPDGFWWAVVTMT
TVGYGDMCPTTPGGKIVGTLCAIAGVLTIALPVPVIVSNFNYFYHRETENEEKQNIPGEI
ERILNSVGSRMGSTDSLNKTNGGCSTEKSRK
Download sequence
Identical sequences G3QZB3
ENSGGOP00000008219 ENSGGOP00000008219 XP_004026360.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]