SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008270 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008270
Domain Number 1 Region: 46-85
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000266
Family EGF-type module 0.016
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000008270
Domain Number - Region: 428-466
Classification Level Classification E-value
Superfamily Cytochrome c oxidase subunit II-like, transmembrane region 0.0817
Family Cytochrome c oxidase subunit II-like, transmembrane region 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008270   Gene: ENSGGOG00000008453   Transcript: ENSGGOT00000008499
Sequence length 474
Comment pep:novel chromosome:gorGor3.1:21:30699088:30766486:1 gene:ENSGGOG00000008453 transcript:ENSGGOT00000008499 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVIGVTNGSVVVEFHLLIIADVDVQEVSAAFLTAFQTAPLLEVIRGDTFIQDYDECERK
EDDCVPGTSCRNTLGSFTCSCEGGAPDFPVEYSQRPCEGDSPGNETWATSPERPLTTAGT
KAAFMQGTSPTPQGLPQRLNLTGAVRVLCEIEKVVVAIQKRFLQQESIPESSLYLSHPSC
NVSHSNGTHVLLEAGWSECGTLMQSNVTNTVVRTTLRNDLSQEGIIHHLKFLSPIYCAFQ
NDLLTSSGFTLEWGVYTIIEDLHGAGNFVTEMQLFIGDSPIPQNYSVSASDDVKIEVGLY
RQKSNLKVVLTECWATPSSNARDPVTFSFINNSCPVPNTYTNVIENGNSNKAQFKLRIFS
FINNSIVYLHCKLRICMESPGATCKINCNNFRLLQNSETSATHQMSWGPLIRSEEAKICE
EASLGAGYVVLIVVAIFVLVAGTATLLIVRYQRMNGRYNFKIQSNNFSYQVFYE
Download sequence
Identical sequences ENSGGOP00000008270 ENSGGOP00000008270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]