SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008475 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008475
Domain Number 1 Region: 33-311
Classification Level Classification E-value
Superfamily L domain-like 1.36e-45
Family Ngr ectodomain-like 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008475   Gene: ENSGGOG00000008670   Transcript: ENSGGOT00000008708
Sequence length 353
Comment pep:novel chromosome:gorGor3.1:11:73789989:73804897:1 gene:ENSGGOG00000008670 transcript:ENSGGOT00000008708 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPWPLLLLLAVSGAQTTRPCFPGCQCEVETFGLFDSFSLTRVDCSGLGPHIMPVPIPLDT
AHLDLSSNRLEMVNESVLAGPGYTTLAGLDLSHNLLTSISPTAFSRLRYLESLDLSHNGL
TALPAESFTSSPLSDVNLSHNQLREVSVSAFTTHSQGRALHVDLSHNLIHRLVPHPTRAG
LPVPTIQSLNLAWNRLHAVPNLRDLPLRYLSLDGNPLAVIGPGAFTGLGGLTHLSLASLQ
RLPELAPNGFHELPGLQVLDLSGNPKLNWAGAEVFSGLSSLQELDLSGTNLVPLPEALLL
HLPALQSVSVGQDVRCRRLVREGTYPRRPGSSPKVALHCVDTRESAARGPTIL
Download sequence
Identical sequences ENSGGOP00000008475 ENSGGOP00000008475

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]