SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008545 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008545
Domain Number 1 Region: 62-158,311-436,986-1208
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 5.62e-53
Family Calcium ATPase, transmembrane domain M 0.026
Further Details:      
 
Domain Number 2 Region: 437-453,779-983
Classification Level Classification E-value
Superfamily HAD-like 2.63e-36
Family Meta-cation ATPase, catalytic domain P 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008545   Gene: ENSGGOG00000008736   Transcript: ENSGGOT00000008779
Sequence length 1309
Comment pep:novel chromosome:gorGor3.1:4:47944060:48028172:1 gene:ENSGGOG00000008736 transcript:ENSGGOT00000008779 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEALQWARYHWRRLIRGATRDDDSGPYNYSSLLACGRKSSQTPKLAGRHRIVVPHIQPF
KDEYEKFSRAYVNNRIRTTKYTLLNFVPRNLFEQFHRAANLYFLFLVVLNWVPLVEAFQK
EITMLPLVVVLTIIAIKDGLEDYRKYKIDKQINNLITKVYKNKEKNFIYLLWKTCIVEEI
VLMFFPQIISGTIIIRPSQVLSKFPPGFLQIEISKLDSNSIMVQNPTGRKSYIDMDDSEV
DPEKFSSRIECESPNNDLSRFRGFLEHSNKERVGLSKENLLLRGCTIRNTEAVVGIVVYA
GHETKAMLNNSGPRYKRSKLERRANTDVLWCVMLLVIMCLTGAVGHGIWLSRYEKMHFFN
IPEPDGHIISPLLAGFYMFWTMIILLQVLIPISLYVSIEIVKLGQIYFIQSDVDFYNEKT
DSIVQCRALNIAEDLGQIQYLFSDKTGTLTENKMVFRRCSVAGFDYCHEENARRLESYQE
AVSEDEDFIDTVSGSLSNMAKPRAPSCRTVHNGPLGNKPSNHLAGSSFTLGSGEGASEVP
HSRQAAFSSPIETDVVPDTRLLDKFSQITPRLFMPLDETIQNPPLETLYIIDFFIALAIC
NTVVVSAPNQPRQKVSKFSNANKGHFPEENFGFKCICTELDMWIKMKGSDESSSFCFSLF
AKLKLSLILLRPPTSYVLYQAKYTVLDSISCLIIFFSFYKIPPLSLECVSLINPLIPEAS
FPKYYIAYNFGLGRQTSFDSPEQLGSLCSVGLSWLTAGFGFLQVLLHFGYFLGATGIEDR
LQEGVPESIEALHKAGIKIWMLTGDKQETAVNIAYACKLLEPDDKLFILNTQSKDACGML
MSTILKELQKKTQALPEQVSLSEDLLQSPVPQDSGLRAGLIITGKTLEFALQESLQKQFL
ELTSWCQAVVCCRATPLQKSEVVKLVRSHLQVMTLAIGDGANDVSMIQVADIGIGVSGQE
GMQAVMASDFAVSQFKHLSKLLLVHGHWCYTRLSNMILYFFYKNVAYVNLLFWYQFFCGF
SGTSMTDYWVLIFFNLLFTSAPPVIYGVLEKDMSAETLMQLPELYKSGQKSEAYLPHTFW
ITLLDAFYQSLVCFFVPYFTYQGSDIDIFAFGNPLNTAALFIILLHLVIESKSLTWIHLL
VIIGSILSYFLFAIVFGAMCVTCNPPSNPYWIMQEHMLDPVFYLVCILTTSIALLPRFVY
RVLQGSLFPSPILRAKHFDRLTPEERTKALKKWRGAGKMNQVTSKYANQSAGKSGRRPMP
GPSAVFAMKSATSCAIEQGNLSLCETALDQGYSETKAFEMAGPSKGKES
Download sequence
Identical sequences ENSGGOP00000008545 ENSGGOP00000028556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]