SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008617 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008617
Domain Number 1 Region: 150-341
Classification Level Classification E-value
Superfamily E set domains 5.13e-54
Family Cytoplasmic domain of inward rectifier potassium channel 0.00024
Further Details:      
 
Domain Number 2 Region: 41-192
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.15e-25
Family Voltage-gated potassium channels 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008617   Gene: ENSGGOG00000008817   Transcript: ENSGGOT00000008853
Sequence length 365
Comment pep:novel chromosome:gorGor3.1:2b:121993736:122004163:-1 gene:ENSGGOG00000008817 transcript:ENSGGOT00000008853 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EIQPEMDSSNCKVIAPLLSQRYRRMVTKDGHSTLQMDGAQRGLAYLRDAWGILMDMRWRW
MMLVFSASFVVHWLVFAVLWYVLAEMNGDLELDHDAPPENHTICVKYITSFTAAFSFSLE
TQLTIGYGTMFPSGDCPSAIALLAIQMLLGLMLEAFITGAFVAKIARPKNRAFSIRFTDI
AVVAHMDGKPNLIFQVANTRPSPLTSVRVSAVLYQERENGKLYQTSVDFHLDGISSDECP
FFIFPLTYYHSITPSSPLATLLQHENPSHFELVVFLSAMQEGTGEICQRRTSYLPSEIML
HHCFASLLTRGSKGEYQIKMENFDKTVPEFPTPLVSKSPNRTDLDIHINGQSIDNFQISE
TGLTE
Download sequence
Identical sequences ENSGGOP00000008617 ENSGGOP00000008617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]