SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008627 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008627
Domain Number 1 Region: 529-719
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.7e-53
Family cAMP-binding domain 0.00000000951
Further Details:      
 
Domain Number 2 Region: 264-532
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.75e-37
Family Voltage-gated potassium channels 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008627   Gene: ENSGGOG00000008824   Transcript: ENSGGOT00000008863
Sequence length 1211
Comment pep:novel chromosome:gorGor3.1:15:52881316:52929582:-1 gene:ENSGGOG00000008824 transcript:ENSGGOT00000008863 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKLPPSMRKRLYSLPQQVGAKAWIMDEEEDAEEEGAGGRQDPSRRSIRLRPLPSPSPSA
AAGGTESRSSALGAGDSEGPARGAGKSSTNGDCRRFRGSLASLGSRGGGSGGTGXXXXRG
TRSGSSHGHLHDSAEERRLIAEGDASPGEDRTPPGLAAEPERPGASAQPAASPPPPQQPP
QPASASCEQPSVDTAIKVEGGAAAGDQILPEAEVRLGQAGFMQRQFGAMLQPGVNKFSLR
MFGSQKAVEREQERVKSAGFWIIHPYSDFRFYWDLTMLLLMVGNLIIIPVGITFFKDENT
TPWIVFNVVSDTFFLIDLVLNFRTGIVVEDNTEIILDPQRIKMKYLKSWFMVDFISSIPV
DYIFLIVETRIDSEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLA
SAVVRIVNLIGMMLLLCHWDGCLQFLVPMLQDFPDDCWVSINNMVNNSWGKQYSYALFKA
MSHMLCIGYGRQAPVGMSDVWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYK
QVEQYMSFHKLPPDTRQRIHDYYEHRYQGKMFDEESILGELSEPLREEIINFNCRKLVAS
MPLFANADPNFVTSMLTKLRFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKETKL
ADGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVALDRLD
RIGKKNSILLHKVQHDLNSGVFNYQENEIIQQIVQHDREMAHCAHRVQAAASATPTPTPL
IWTPLIQAPLQAAAATTSVAIALTHHPRLPAAIFRPPPGSGLGNLGAGQTPRHLKRLQSL
IPSALGSASPASSPSQVDTPSSSSFHIQQLAGFSAPAGLSPLLPSSSSSPPPGACGSPSA
PTPSAGAAATTIAGFGHFHKALGGSLSSSDSPLLTPLQPGARSPQAAQPPPAPPGARGGL
GLPEHFLPPPPSSRSPSYSPGQLGQPPGELSLGLATGPLSTPETPPRQPEPPSLVAGASG
GASPVGFTPRGGLSPPGHSPGPPRTFPSAPPRASGSHGSLLLPPASSPPPPQVPQRRGTP
PLTPGRLTQDLKLISASQPALPQDGAQTLRRASPHSSGESMAAFPLFPRAGGGSGGSGSS
RGLGPPGRPYGAIPGQHVTLPRKTSSGSLPPPLSLFGARATSSGGPPLTAGPQREPGARP
EPVRSKLPSNL
Download sequence
Identical sequences ENSGGOP00000008627 ENSGGOP00000026186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]