SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008790 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008790
Domain Number 1 Region: 13-161
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.33e-54
Family Dual specificity phosphatase-like 0.0000000644
Further Details:      
 
Domain Number 2 Region: 162-338
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.04e-48
Family Dual specificity phosphatase-like 0.0000000171
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008790   Gene: ENSGGOG00000008986   Transcript: ENSGGOT00000009029
Sequence length 461
Comment pep:novel chromosome:gorGor3.1:9:78541979:78608660:-1 gene:ENSGGOG00000008986 transcript:ENSGGOT00000009029 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSREGAGAALVAEVIKDRLCFAILYSRPKSASNVHYFSIDNELEYENFYADFGPLNLAMV
YRYCCKINKKLKSITMLRKKIVHFTGSDQRKQANAAFLVGCYMVIYLGRTPEEAYRILIF
GETSYIPFRDAAYGSCNFYITLLDCFHAVKKAMQYGFLNFNSFNLDEYEHYEKAENGDLN
WIIPDRFIAFCGPHSRARLESGYHQHSPETYIQYFKNHNVTTIIRLNKRMYDAKRFTDAG
FDHHDLFFADGSTPTDAIVKEFLDICENAEGAIAVHCKAGLGRTGTLIACYIMKHYRMTA
AETIAWVRICRPGSVIGPQQQFLVMKQTNLWLEGDYFRQKLKGQENGQHRAAFSKLLSGV
DDVSINGVENQDQQEPEPYSDDDEINGVTQGDRLRALKSRRQSKTNAIPLTVILQSSVQS
CKTSEPNISGSAGITKRTTRSASRKSSVKSLSISRTKTVLR
Download sequence
Identical sequences G3R0U4
ENSGGOP00000008790 XP_004048360.1.27298 ENSGGOP00000008790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]