SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008947 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008947
Domain Number 1 Region: 186-323
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.73e-48
Family Galectin (animal S-lectin) 0.00032
Further Details:      
 
Domain Number 2 Region: 11-157
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.19e-48
Family Galectin (animal S-lectin) 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008947   Gene: ENSGGOG00000009152   Transcript: ENSGGOT00000009195
Sequence length 323
Comment pep:novel chromosome:gorGor3.1:19:36190799:36202314:-1 gene:ENSGGOG00000009152 transcript:ENSGGOT00000009195 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAYVPAPGYQPTYNPTLPYYQPIPGGLNMGMSVYIQGVASEHMKRFFVNFVVGQDPGSDI
AFHFNPRFDGWDKVVFNTLQGGKWGSEERKRSMPFKKGAAFELVFIVLAEHYKVVVNGNP
FYEYAHRLPLQMVTHLQVDGDLQLQSINFIGGQPSRPQGPPMMPPYPGPGHCHQQLNSLP
TMEGPPTFNPPVPYFGRLQGGLTARRTIIIKGYVPPTGKSFAINFKVGSSGDIALHINPR
MGNSTVVRNSLLNGSWGSEEKKITHNPFGPGQFFDLSIRCGLDRFKVYANGQHLFDFAHR
LSAFQRVDTLEIQGDVTLSYVQI
Download sequence
Identical sequences G3R192
ENSGGOP00000008947 XP_004060727.1.27298 ENSGGOP00000008947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]