SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009295 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009295
Domain Number 1 Region: 42-124
Classification Level Classification E-value
Superfamily Cystatin/monellin 1.87e-16
Family Cystatins 0.011
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000009295
Domain Number - Region: 124-148
Classification Level Classification E-value
Superfamily Nqo1C-terminal domain-like 0.0366
Family Nqo1C-terminal domain-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009295   Gene: ENSGGOG00000009518   Transcript: ENSGGOT00000009555
Sequence length 159
Comment pep:novel chromosome:gorGor3.1:20:24209869:24213393:-1 gene:ENSGGOG00000009518 transcript:ENSGGOT00000009555 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSPQKRKALPWALSLLLMGFQLLVTYAWCSEEEMGGNNKIVQDPTFLATVEFALNTFNV
QSKEEHAYRLLRVLSSWREDSMDRKWRGKMVFSMNLQMRQTVCRKFEDDIENCPFQESLE
LNNVRQGISFPQVHSCGCCMGCGVGTGAADKAIPRDKGK
Download sequence
Identical sequences G3R255
XP_004061951.1.27298 ENSGGOP00000009295 ENSGGOP00000009295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]