SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009619 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009619
Domain Number 1 Region: 75-252
Classification Level Classification E-value
Superfamily EF-hand 1.24e-48
Family Calmodulin-like 0.000000378
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009619   Gene: ENSGGOG00000009841   Transcript: ENSGGOT00000009886
Sequence length 256
Comment pep:novel chromosome:gorGor3.1:2a:92921728:93012626:1 gene:ENSGGOG00000009841 transcript:ENSGGOT00000009886 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPAKEVTKASDGSLLGDLGHTPLSKKEGVKWQRPRLSRQALMRCCLVKWILSSTAPQGS
DSSDSELELSTVRHQPEGLDQLQAQTKFTKKELQSLYRGFKNECPTGLVDEDTFKLIYAQ
FFPQGDATTYAHFLFNAFDADGNGAIHFEDFVVGLSILLRGTVHEKLKWAFNLYDINKDG
YITKEEMLAIMKSIYDMMGRHTYPILREDAPAEHVERFFEKMDRNQDGVVTIEEFLETCQ
KDENIMSSMQLFENVI
Download sequence
Identical sequences G3R304
ENSGGOP00000009619 ENSGGOP00000009619 XP_018877036.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]