SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009725 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009725
Domain Number 1 Region: 116-168
Classification Level Classification E-value
Superfamily Orange domain-like 0.00000000000000981
Family Hairy Orange domain 0.0000529
Further Details:      
 
Domain Number 2 Region: 50-127
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000628
Family HLH, helix-loop-helix DNA-binding domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009725   Gene: ENSGGOG00000009960   Transcript: ENSGGOT00000010003
Sequence length 308
Comment pep:novel chromosome:gorGor3.1:8:78294315:78298163:-1 gene:ENSGGOG00000009960 transcript:ENSGGOT00000010003 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRAHPEYSSSDSELDETIEVEKESADENGNLSSALGSMSPTTSSQILARKRRRGIIEKR
RRDRINNSLSELRRLVPSAFEKQVMEQGSAKLEKAEILQMTVDHLKMLHTAGGKGYFDAH
ALAMDYRSLGFRECLAEVARYLSIIEGLDASDPLRVRLVSHLNNYASQREAASGAHAGLG
HIPWGTVFGHHPHIAHPLLLPQNGHGNAGTTASPTEPHHQGRLGSAHPEAPALRAPPSGS
LGPVLPVVTSASKLSPPLLSSVASLSAFPFSFGSFHLLSPNALSPSAPTQAANLGKPYRP
WGTEIGAF
Download sequence
Identical sequences A0A2J8M9W8 A0A2J8VA05 G3R3A1
ENSPTRP00000034843 9598.ENSPTRP00000034843 9606.ENSP00000338272 NP_001035798.1.87134 NP_001035798.1.92137 XP_008954913.1.60992 XP_009242170.1.23681 XP_009453814.1.37143 XP_018888431.1.27298 ENSGGOP00000009725 ENSPTRP00000034843 ENSP00000338272 gi|105990526|ref|NP_001035798.1| ENSGGOP00000009725 ENSP00000346761 ENSP00000338272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]