SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009846 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009846
Domain Number 1 Region: 61-256
Classification Level Classification E-value
Superfamily Sec7 domain 1.1e-78
Family Sec7 domain 0.00000000459
Further Details:      
 
Domain Number 2 Region: 265-380
Classification Level Classification E-value
Superfamily PH domain-like 9.38e-35
Family Pleckstrin-homology domain (PH domain) 0.00000169
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009846   Gene: ENSGGOG00000010087   Transcript: ENSGGOT00000010129
Sequence length 402
Comment pep:novel chromosome:gorGor3.1:5:4403909:4456433:1 gene:ENSGGOG00000010087 transcript:ENSGGOT00000010129 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVTLPSIFVVPSDLTAEERQELENIRRRKQELLADIQRLKDEIAEVANEIENLGSTEERK
NMQRNKQVAMGRKKFNMDPKKGIQFLIENDLLKNTCEDIAQFLYKGEGLNKTAIGDYLGE
RDEFNIQVLHAFVELHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCQCNNG
VFQSTALDTCYVLSFAIIMLNTSLHNPNVKDKPTVERFIAMNRGINDGGDLPEELLRNLY
ESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLAGGRVKTWKRRWFILTDNCLYYFEYT
TDKEPRGIIPLENLSIREVEDSKKPNCFELYIPDNKDQVIKACKTEADGRVVEGNHTVYR
ISAPTPEEKEEWIKCIKAAISRDPFYEMLAARKKKVSSTKRH
Download sequence
Identical sequences ENSGGOP00000021991 ENSGGOP00000009846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]