SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000009898 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000009898
Domain Number 1 Region: 129-265
Classification Level Classification E-value
Superfamily CBS-domain pair 0.00000000000000419
Family CBS-domain pair 0.0073
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000009898
Domain Number - Region: 361-411,443-469
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.000249
Family cAMP-binding domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000009898   Gene: ENSGGOG00000010143   Transcript: ENSGGOT00000010183
Sequence length 527
Comment pep:novel chromosome:gorGor3.1:2a:94327007:94342812:1 gene:ENSGGOG00000010143 transcript:ENSGGOT00000010183 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ARRLEPARRWAGCALGALLLLASLAQAALAVLLYRAAGQRAVPAVLGSAGLVFLVGEVVP
AAVSGRWTLALAPRALGLSRLAVLLTLPVALPVGQLLELAARPGRLRERVLELARGGGDP
YSDLSKGVLRCRTVEDVLTPLEDCFMLDASTVLDFGVLASIMQSGHTRIPVYEEERSNIV
DMLYLKDLAFVDPEDCTPLSTITRFYNHPLHFVFNDTKLDAVLEEFKRGKSHLAIVQKVN
NEGEGDPFYEVLGLVTLEDVIEEIIRSEILDESEDYRDTVVKRKPASLMAPLKRKEEFSL
FKVSDDEYKVKISPQLLLATQRFLSREVDVFSPLRISEKVLLHLLKHPSVNQEVRFDESN
RLATHHYLYQRSQPVDYFILILQGRVEVEIGKEGLKFENGAFTYYGVSALTVPSSVHQSP
VSSLQPIRHDLQPDPGDGTRSSAYCPDYTVRALSDLQLIKVTRLQYLNALLATRAQNLPQ
SPENTDLQVIPGSQTRLLGEKTTTAAGSSHSRPGVPVEGSPGRNPGV
Download sequence
Identical sequences ENSGGOP00000009898 ENSGGOP00000009898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]