SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010019 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010019
Domain Number 1 Region: 338-450
Classification Level Classification E-value
Superfamily SMAD/FHA domain 2.68e-23
Family FHA domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010019   Gene: ENSGGOG00000010269   Transcript: ENSGGOT00000010309
Sequence length 646
Comment pep:novel chromosome:gorGor3.1:17:20657975:20689341:-1 gene:ENSGGOG00000010269 transcript:ENSGGOT00000010309 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SQVEELSKILQRGRNEDNKKSDVEVQTENHAPWSISDYYYQTYYNDVSLPNKVTELSDQQ
DQAIETSILNSKDHLQVENDAYPGTDRTENVKCRQVDHFASNSQEPASALATEDTSLEGS
SLAESLRAAAEAAVSQTGFSYDENTGLYFDHSTGFYYDSENQLYYDPSTGIYYYCDVESG
RYQFHSRVDLQPYQTSSTKQSKDKKLKKKRKDPDSSATNEEKDLNSEDQKAFSVEHTSCN
EEENFANMKKKAKIGIHHKNSPPKVTVPTSGNTIESPLHENISNSASFKDEKIMETDSEP
EEGEITDSQTEDSFDEDITSEGNVTAEDSEDEDEDKIWPPCIRVIVIRSPVLQIGSLFII
TAVNPATIGREKDMKHTLRIPEVGVSKFHAEIYFDHDLQSYVLVDQGSQNGTIVNGKQIL
QPKTKCDPYVLEHGDEVKIGETVLSFHIHPGSDTCDGCEPGQVRAHLRLDKKDESFVGPT
LSKEEKELERRKELKKIRVKYGLQNTEYEDEKTLKNPKYKDRAGKRREQVGSEGTFQRDD
APASVHSEITDSNKGRKMLEKMGWKKGEGLGKDGGGMKMPIQLQLRRTHAGLGTGKPSSI
EDVHLLQNKNKKNWDKARERFTENFPETKPQKDDPGTMPWVKGTLE
Download sequence
Identical sequences ENSGGOP00000010019 ENSGGOP00000010019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]