SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010139 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010139
Domain Number 1 Region: 319-603
Classification Level Classification E-value
Superfamily Kelch motif 6.28e-62
Family Kelch motif 0.0000754
Further Details:      
 
Domain Number 2 Region: 55-167
Classification Level Classification E-value
Superfamily POZ domain 1.02e-30
Family BTB/POZ domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010139   Gene: ENSGGOG00000010394   Transcript: ENSGGOT00000010434
Sequence length 621
Comment pep:novel chromosome:gorGor3.1:3:184820762:184897205:-1 gene:ENSGGOG00000010394 transcript:ENSGGOT00000010434 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLMAGQRGTWTMGDVVEKSLEGPLAPSTDEPSQKTGDLVEILNGEKVKFDDAGLSLILQN
GLETLRMENALTDVILCVDIQEFSCHRVVLAAASNYFRAMFCNDLKEKYEKRIIIKGVDA
ETMHTLLDYTYTSKALITKQNVQRVLEAANLFQFLRMVDACASFLTEALNPENCVGILRL
ADTHSLDSLKKQVQSYIIQNFVQILNSEEFLDLPVDTLHHILKSDDLYVTEEAQVFETVM
SWVRHKPSERLCLLPYVLENVRLPLLDPWYFVETVEADPLIRQCPEVFPLLQEARMYHLS
GNEIISERTKPRMHEFQSEVFMIIGGCTKDERFVAEVTCLDPLRRSRLEVAKLPLTEHEL
ESENKKWVEFACVTLKNEVYISGGKETQHDVWKYNSSINKWIQIEYLNIGRWRHKMVVLG
GKVYVIGGFDGLQRINNVETYDPFHNCWSEAAPLLVHVSSFAATSHKKKLYVIGGGPNGK
LATDKTQCYDPSTNKWSLKAAMPVEAKCINAVSFRDRIYVVGGAMRALYAYSPLEDSWCL
VTQLSHERASCGIAPCNNRLYITGGRDEKNEVIATVLCWDPEAQKLTEECVLPRGVSHHG
SVTIRKSYTHIRRIVPGAVSV
Download sequence
Identical sequences G3R4D9
ENSGGOP00000010139 XP_004038129.1.27298 ENSGGOP00000010139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]