SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010290 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010290
Domain Number 1 Region: 85-304
Classification Level Classification E-value
Superfamily SMAD/FHA domain 3.68e-67
Family SMAD domain 0.00017
Further Details:      
 
Domain Number 2 Region: 1-82
Classification Level Classification E-value
Superfamily SMAD MH1 domain 1.44e-23
Family SMAD MH1 domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010290   Gene: ENSGGOG00000010554   Transcript: ENSGGOT00000010594
Sequence length 306
Comment pep:novel chromosome:gorGor3.1:18:46628251:46662500:-1 gene:ENSGGOG00000010554 transcript:ENSGGOT00000010594 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QAVESRGGTRTACLLLPGRLDCRLGPAQSPSSYSLPLLLCKVFRWPDLRHSSEVKRLCCC
ESYGKINPELVCCNPHHLSRLCELESPPPPYSRYPMDFLKPTADCPDAVPSSAETGGTNY
LAPGGLSDSQLLLEPGDRSHWCVVAYWEEKTRVGRLYCVQEPSLDIFYDLPQGNGFCLGQ
LNSDNKSQLVQKVRSKIGCGIQLTREVDGVWVYNRSSYPIFIKSATLDNPDSRTLLVHKV
FPGFSIKAFDYEKAYSLQRPNDHEFMQQPWTGFTVQISFVKGWGQCYTRQFISSCPCWLE
VIFNSR
Download sequence
Identical sequences ENSGGOP00000010290 ENSGGOP00000010290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]