SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010479 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010479
Domain Number 1 Region: 159-272
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.98e-36
Family Spermadhesin, CUB domain 0.00014
Further Details:      
 
Domain Number 2 Region: 316-440
Classification Level Classification E-value
Superfamily TIMP-like 8.01e-36
Family Netrin-like domain (NTR/C345C module) 0.000000304
Further Details:      
 
Domain Number 3 Region: 37-147
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-34
Family Spermadhesin, CUB domain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010479   Gene: ENSGGOG00000010740   Transcript: ENSGGOT00000010787
Sequence length 449
Comment pep:novel chromosome:gorGor3.1:7:98097676:98103596:1 gene:ENSGGOG00000010740 transcript:ENSGGOT00000010787 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPAATASLLGPLLTACALLPFAQGQTPNYTRPVFLCGGDVKGESGYVASEGFPNLYPPN
KECIWIITVPEGQTVSLSFRVFDLELHPACRYDALEVFAGSGTSGQRLGRFCGTFRPAPL
VAPGNQVTLRMTTDEGTGGRGFLLWYSGRATSGTEHQFCGGRLEKAQGTLTTPNWPESDY
PPGISCSWHIIAPPDQVIALTFEKFDLEPDTYCRYDSVSVFNGAVSDDSRRLGKFCGDAV
PGSISSEGNELLVQFVSDLSVTADGFSASYKTLPRGTAKEGQGPSPKPGTEPKVKLPPKS
QPPEKTEETPSAPDAPTCPKQCRRTGTLQSNFCASSLVVTATVKSMVREPGEGLAVTVSL
IGAYKTGGLDLPSPPTGASLKFYVPCKQCPPMKKGVSYLLMGQVEENRGPVLPPESFVVL
HRPNQDQILTNLSKRKCPSQPVRAAASQD
Download sequence
Identical sequences G3R5A8
XP_004045959.1.27298 ENSGGOP00000010479 ENSGGOP00000010479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]