SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000010528 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000010528
Domain Number 1 Region: 735-910
Classification Level Classification E-value
Superfamily Chaperone J-domain 6.93e-48
Family Chaperone J-domain 0.0000000113
Further Details:      
 
Domain Number 2 Region: 60-216
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.8e-27
Family Dual specificity phosphatase-like 0.00028
Further Details:      
 
Domain Number 3 Region: 224-361
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 9.15e-27
Family PLC-like (P variant) 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000010528   Gene: ENSGGOG00000010799   Transcript: ENSGGOT00000010837
Sequence length 910
Comment pep:novel chromosome:gorGor3.1:1:67507503:67559120:1 gene:ENSGGOG00000010799 transcript:ENSGGOT00000010837 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FFLAGASSPDMEPSYGGGLFDMVKGGAGRLFSNLKDNLKDTLKDTSSRVIQSVTSYTKGD
LDFTYVTSRIIVMSFPLDNVDIGFRNQVDDIRSFLDSRHLDHYTVYNLSPKSYRTAKFHS
RVSECSWPIRQAPSLHNLFAVCRNMYNWLLQNPKNVCVVHCLDGRAASSILVGAMFIFCN
LYSTPGPAIRLLYAKRPGIGLSPSHRRYLGYMCDLLADKPYRPHFKPLTIKSITVSPIPF
FNKQRNGCRPYCDVLIGETKIYSTCTDFERMKEYRVQDGKIFIPLNITVQGDVVVSMYHL
RSTIGSRLQAKVTNTQIFQLQFHTGFIPLDTTVLKFTKPELDACDVPEKYPQLFQVTLDV
ELQPHDKVIDLTPPWEHYCTKDVNPSILFSSHQEHQDTLALGGQAPIDIPPDNPRHYGQS
GFFASLCWQDQKSEKSFCEEDHAALVNQESEQSDDELLTLSSPHGNANGDKPHGVKKPSK
KQQEPAAPPPPEDVDLLGLEGSAVSNSFSPPAAPPTNSELLSDLFGGGGAAGPTQAGQSG
VEDVFHPSGPASTQSTPRRSATSTSASPTLRVGEGATFDPFGAPSKPSGQDLLGSFLNTS
SASSDPFLQPTRSPSPTVHASSTPAVNIQPDVSGGWDWHAKPGGFGMGSKSAATSPTGSS
HGTPTHQNKPQTLDPFADLGTLGSSSFASKPTTPTGLGGGFPPLSSPQKASPQPMGGGWQ
QGGAYNWQQPQPKPQPSMPHSSPQNRPNYNVSFSAMPGGQNERGKGSSNLEGKQKAADFE
DLLSGQGFNAHKDKKGPRTIAEMRKEEMAKEMDPEKLKILEWIEGKERNIRALLSTMHTV
LWAGETKWKPVGMADLVTPEQVKKVYRKAVLVVHPDKATGQPYEQYAKMIFMELNDAWSE
FENQGQKPLY
Download sequence
Identical sequences ENSGGOP00000010528 ENSGGOP00000010528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]