SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011032 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011032
Domain Number 1 Region: 337-450,569-708
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.3e-63
Family Phosphate binding protein-like 0.00000000288
Further Details:      
 
Domain Number 2 Region: 2-316
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.45e-54
Family L-arabinose binding protein-like 0.0047
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000011032
Domain Number - Region: 472-564
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00118
Family Voltage-gated potassium channels 0.018
Further Details:      
 
Domain Number - Region: 692-794
Classification Level Classification E-value
Superfamily Tetrahydrobiopterin biosynthesis enzymes-like 0.0267
Family DHN aldolase/epimerase 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011032   Gene: ENSGGOG00000011315   Transcript: ENSGGOT00000011359
Sequence length 822
Comment pep:novel chromosome:gorGor3.1:1:38052596:38139000:-1 gene:ENSGGOG00000011315 transcript:ENSGGOT00000011359 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ACDQLALGVVAIFGPSQGSCTNAVQSICNALEVPHIQLRWKHHPLDNKDTFYVNLYPDYA
SLSHAILDLVQYLKWRSATVVYDDSTGLIRLQELIMAPSRYNIRLKIRQLPIDSDDSRPL
LKEMKRGREFRIIFDCSHTMAAQILKQAMAMGMMTEYYHFIFTTLDLYALDLEPYRYSGV
NLTGFRILNVDNPHVSAIVEKWSMERLQAAPRAESGLLDGVMMTDAALLYDAVHIVSVCY
QRAPQMTVNSLQCHRHKAWRFGGRFMNFIKEAQWEGLTGRIVFNKTSGLRTDFDLDIISL
KEDGLEKVGVWSPADGLNITEVAKGRGPNVTDSLTNRSLIVTTVLEEPFVMFRKSDRTLY
GNDRFEGYCIDLLKELAHILGFSYEIRLVEDGKYGAQDDKGQWNGMVKELIDHKADLAVA
PLTITHVREKAIDFSKPFMTLGVSILYRKPNGTNPSVFSFLNPLSPDIWMYVLLAYLGVS
CVLFVIARFSPYEWYDAHPCNPGSEVVENNFTLLNSFWFGMGSLMQQGSELMPKALSTRI
IGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVKDGATMTFFK
KSKISTFEKMWAFMSSKPSALVKNNEEGIQRALTADYALLMESTTIEYVTQRNCNLTQIG
GLIDSKGYGIGTPMGSPYRDKITIAILQLQEEDKLHIMKEKWWRGSGCPEEENKEASALG
IQKIGGIFIVLAAGLVLSVLVAVGEFVYKLRKTAEREQRSFCSTVADEIRFSLTCQRRIK
HKPQPPMMVKTDAVINMHTFNDRRLPGKDSMACSTSLAPVFP
Download sequence
Identical sequences ENSGGOP00000011032 ENSGGOP00000011032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]