SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011118 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011118
Domain Number 1 Region: 5-289
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 6.49e-76
Family BAR domain 0.0022
Further Details:      
 
Domain Number 2 Region: 397-574
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 8.44e-51
Family BCR-homology GTPase activation domain (BH-domain) 0.00000125
Further Details:      
 
Domain Number 3 Region: 263-370
Classification Level Classification E-value
Superfamily PH domain-like 4.21e-16
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 
Domain Number 4 Region: 818-873
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000042
Family SH3-domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011118   Gene: ENSGGOG00000011397   Transcript: ENSGGOT00000011445
Sequence length 874
Comment pep:novel chromosome:gorGor3.1:11:98157843:98466359:1 gene:ENSGGOG00000011397 transcript:ENSGGOT00000011445 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLPTLEFSDSYLDSPDFRERLQCHEIELERTNKFIKELIKDGSLLIGALRNLSMAVQKF
SQSLQDFQFECIGDAETDDEISIAQSLKEFARLLIAVEEERRRLIQNANDVLIAPLEKFR
KEQIGAAKDGKKKFDKESEKYYSILEKHLNLSAKKKESHLQEADTQIDREHQNFYEASLE
YVFKIQEVQEKKKFEFVEPLLSFLQGLFTFYHEGYELAQEFAPYKQQLQFNLQNTRNNFE
STRQEVERLMQRMKSANQDYRPPSQWTMEGYLYVQEKRPLGFTWIKHYCTYDKGSKTFTM
SVSEMKSSGKMNGLVTSSPEMFKLKSCIRRKTDSIDKRFCFDIEVVERHGIITLQAFSEA
NRKLWLEAMDGKEPIYTLPAIISKKEEMYLNEAGFNFVRKCIQAVETRGITILGLYRIGG
VNSKVQKLMNTTFSPKSPPDIDIDIELWDNKTITSGLKNYLRCLAEPLMTYKLHKDFIIA
VKSDDQNYRVEAVHALVHKLPEKNREMLDILIKHLVKVSLHSQQNLMTVSNLGVIFGPTL
MRAQEETVAAMMNIKFQNIVVEILIEHYEKIFHTAPDPSIPLPQPQSRSGSRRTRAICLS
TGSRKPRGRYTPCLAEPDSDSYSSSPDSTPMGSIESLSSHSSEQNSTTKSASCQPREKSG
GIPWIATPSSSNGQKSLGLWTTSPESSSREDATKTDAESDCQSVASVTSPGDVSPPIDLV
KKEPYGLSGLKRASASSLRSISAAEGNKSYSGSIQSLTSVGSKETPKASPNPDLPPKMCR
RLRLDTASSNGYQRPGSVVAAKAQLFENVGSPKPVSSGRQAKAMYSCKAEHSHELSFPQG
AIFSNVYPSVEPGWLKATYEGKTGLVPENYVVFL
Download sequence
Identical sequences A6NI28 G3R6Z3 H2Q4L7
ENSGGOP00000011118 NP_689645.2.87134 NP_689645.2.92137 XP_003828445.1.60992 XP_009422309.1.37143 XP_018893191.1.27298 ENSPTRP00000007230 ENSP00000298815 ENSPTRP00000007230 ENSP00000298815 ENSP00000298815 ENSGGOP00000011118 gi|221307575|ref|NP_689645.2| 9606.ENSP00000298815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]