SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011240 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011240
Domain Number 1 Region: 680-866,1108-1191
Classification Level Classification E-value
Superfamily Cysteine proteinases 8.24e-79
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0000123
Further Details:      
 
Domain Number 2 Region: 178-356
Classification Level Classification E-value
Superfamily EF-hand 2.47e-26
Family Calmodulin-like 0.0018
Further Details:      
 
Domain Number 3 Region: 370-424,518-585
Classification Level Classification E-value
Superfamily DUSP-like 3.66e-24
Family DUSP, domain in ubiquitin-specific proteases 0.0038
Further Details:      
 
Domain Number 4 Region: 18-164
Classification Level Classification E-value
Superfamily EF-hand 0.000000000134
Family Calmodulin-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011240   Gene: ENSGGOG00000011515   Transcript: ENSGGOT00000011569
Sequence length 1392
Comment pep:novel chromosome:gorGor3.1:5:23425592:23681966:1 gene:ENSGGOG00000011515 transcript:ENSGGOT00000011569 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAKESRIGFLSYEEALRRVTDVELKRLKDAFKRTRGLSYYMGQHCFIREVLGDGVPPRV
AEVIYCSFGGTSKGLHFNNLIVGLVLLTRGKDEEKAKYTFSLFSSQSGNYIIREEMERML
HVVDGKVPDTLRKCFSEGEKVNYEKFRNWLFLNKDAFTFSRWLLSGGVYVTLTDDSDTPT
FYQTLAGVTHLEESDIIDLEKRYWLLKAQSRTGRFDLETFGPLVSPPIRPSLSEGLFNAF
DENRDNHIDFKELSCGLSACCRGPLAERQKFCFKVFDVDRDGVLSRVELRDMVVALLEVW
KDNRTDDIPELHMDLSDIVEGILSAHDTTKMGHLTLEDYQIWSVKNVLANEFLNLLFQVC
HIVLGLRPATPEEEGQIIRGWLERESRYGLQPGHNWFIISMQWWQQWKEYVKYDANPVVI
EPSSVLNGGKYSFGTAAHPMEQVEDRIGSSLSYVNTTEEKFSDNISTASEASETAGSGFL
YSATPGADVCFARQHNTSDNNNQCLLGANGNILLHLNPQKPGAIDNQPLVTQEPVKATSL
TLEGGRLKRTPQLIHGRDYEMVPEPVWRALYHWYGANLALPRPVIKNSKTDIPELELFPR
YLLFLRQQPATRTQQSNIWVNMNCLTLLDDENHRLEYLKIQDKQHLVIEVRSKDTSWPEE
MSFIANSSKIDRHKVPIEKGATGLSNLGNTCFMNSSIQCVSNTQPLTQYFISGRHLYELN
RTNPIGMKGHMAKCYGDLVRELSGTQKSVAPLKLQWTIAKYAPRFNGFQQQDSQELLAFL
LDGLHEDLNRVHEKPYVELKDSDGRPDWEVAAEAWDNHLRRNRSIVVDLFHGQLRSQVKC
KTCGHISVRFDPFNFLSLPLPMDSYMHLEITVIKLDGTTPVRYGLRLNMDEKYTGLKKQL
SDLCGLNAEQILLAEVHGSNIKNFPQDNQKVRLSVSGFLCAFEIPVPASPISASSSTQTM
RTELYFLSSQKNRPSLFGMPLIVPCTVHTRKKDLYDAVWIQVSRLASPLPPQEASNHAQD
CDDSMGYQYPFTLRVVQKDGNSCAWCPWYRFCRGCKIDCGEDRAFIGNAYIAVDWDPTAL
HLRYQTSQERVVDEHESVEQSRRAQAEPINLDSCLRAFTSEEELGENEMYYCSKCKTHCL
ATKKLDLWRLPPILIIHLKRFQFVNGRWIKSQKIVKFPRESFDPSAFLVPRDPALCQRKP
LTPQGDELSEPRILAREVKKVDAQSSAGEEDVLLSKSPSSLSANISSSPKGSPSSSRKSG
TSCPSSKNSSPNSSPRTLGRSKGRLRLPQIGSKNKLSSSKENLDASRENGAGQICELADA
LSRGHVLGGSQPELVTPQDHEVALANGFLYEHEACGNGYSNGQLGNHSEEDSTDDQREDT
RIKPIYNLYAIS
Download sequence
Identical sequences ENSGGOP00000011240 ENSGGOP00000011240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]