SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011512 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011512
Domain Number 1 Region: 207-546
Classification Level Classification E-value
Superfamily Rap/Ran-GAP 3.66e-104
Family Rap/Ran-GAP 0.000000806
Further Details:      
 
Domain Number 2 Region: 658-738
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000679
Family PDZ domain 0.018
Further Details:      
 
Domain Number 3 Region: 904-998
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000068
Family Myosin rod fragments 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011512   Gene: ENSGGOG00000011796   Transcript: ENSGGOT00000011845
Sequence length 1019
Comment pep:novel chromosome:gorGor3.1:11:62506491:62516414:1 gene:ENSGGOG00000011796 transcript:ENSGGOT00000011845 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPMWAGGVGSPRRGMAPASTDDLFARKLRQPARPPLTPHTFEPRPVRGPLLRSGSDAGEA
RPPTPASPRARAHSHEEASRPAATSTRLFTDPLALLGLPAEEPEPAFPPVLEPRWFAHYD
VQSLLFDWAPRSQGMGSHSEASSGTLASAEDQAASSDLLHGAPGFVCELGGEGELGLGGP
ASPPVPPALPNAAVSILEEPQNRTSAYSLEHADLGAGYYRKYFYGKEHQNFFGMDESLGP
VAVSLRREEKEGSGGGTLHSYRVIVRTTQLRTLRGTISEDALPPGPPRGLSPRKLLEHVA
PQLSPSCLRLGSASPKVPRTLLTLDEQVLSFQRKVGVLYCRAGQGSEEEMYNNQEAGPAF
MQFLTLLGNVVRLKGFESYRAQLDTKTDSTGTHSLYTTYQDHEIMFHVSTMLPYTPNNQQ
QLLRKRHIGNDIVTIVFQEPGSKPFCPTTIRSHFQHVFLVVRAHAPCTPHTSYRVAVSRT
QDTPAFGPALPAGGGPFAANADFRAFLLAKALNGEQAAGHARQFHAMATRTRQQYLQDLA
TNEVTTTSLDSASRFGLPSLGGELQAAGSLVWGAQASGPEGVEVPCLLGISAEALVLVAP
RDGRVVFNCACRDVLAWTFSEQQLDLYHGRGEAITLRFDGSPGQAVGEVVARLQLVSRGC
ETRELALPRDGQGRLGFEVDAEGFVTHVERFTFAETAGLRPGARLLRVCGQTLPNLRPEA
AAQLLRSAPKVCVTVLPPDESGRPRRSFSELYTLSLQEPSRRGAPDPVQDEVQGVTLLPT
TKQLLHLCLQDGGSPPGPGDLAEERTEFLHSQNSLSPRSSLSDEAPVLPNTTPDLLLATT
AKPSVPSADSETPLTQDRTGSPSGSEDKGNPAPELRASFLPRTLSLRNSISRIMSEAGSG
TLEDEWQAISEIASTCNTILESLSREGQPIPESGDPKGTPKSDAEPEPGNLSEKVSHLES
MLRKLQEDLQKEKADRAALEEEVRSLRHNNRRLQAESESAATRLLLASKQLGSPTTDLA
Download sequence
Identical sequences ENSGGOP00000011512 ENSGGOP00000011512

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]