SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011599 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011599
Domain Number 1 Region: 20-266
Classification Level Classification E-value
Superfamily Aquaporin-like 2.88e-67
Family Aquaporin-like 0.0000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011599   Gene: ENSGGOG00000011888   Transcript: ENSGGOT00000011935
Sequence length 300
Comment pep:novel chromosome:gorGor3.1:1:133314999:133318942:1 gene:ENSGGOG00000011888 transcript:ENSGGOT00000011935 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VFTQALAEIMGHLRIRSLLARQCLAEFLGVFVLMLLTQGAVAQAVTSGETKGNFFTMFLA
GSLAVTIAIYVGGNVSGAHLNPAFSLAMCIVGRLPWVKLPIYILVQLLSAFCASGATYVL
YYDALQNYTGGNLTVTGPKETASIFATYPAPYLSLNNGFLDQVLGTGMLIVGLLAILDRR
NKGVPAGLEPVVVGMLILALGLSMGANCGIPLNPARDLGPRLFTYVAGWGPEVFSAGNGW
WWVPVVAPLVGATVGTATYQLLVALHHPEDPEPAQDLVSAQHKASELETPASAQMLECKL
Download sequence
Identical sequences ENSGGOP00000011599 ENSGGOP00000011599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]