SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011638 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011638
Domain Number 1 Region: 172-425
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 1.26e-93
Family Fibrinogen C-terminal domain-like 0.0000000000655
Further Details:      
 
Domain Number 2 Region: 30-167
Classification Level Classification E-value
Superfamily Fibrinogen coiled-coil and central regions 1.24e-61
Family Fibrinogen coiled-coil and central regions 0.00000847
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011638   Gene: ENSGGOG00000011928   Transcript: ENSGGOT00000011975
Sequence length 437
Comment pep:novel chromosome:gorGor3.1:4:164959896:164968507:-1 gene:ENSGGOG00000011928 transcript:ENSGGOT00000011975 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSWSLHPRNLILYFYALLFLSSTCVAYVATRDNCCILDERFGSYCPTTCGIADFLSTYQT
KVDKDLQSLEDILHQVENKTSEVKQLIKAIQLTYNPDESSKPNMIDAATMKSRKMLEEIM
KYEALILTHDSSIRYLQEIYNSNNQKIVNLKEKVSQLEAQCQEPCKDTVQIHDITGKDCQ
DIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEG
FGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKY
RLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGW
WMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLTI
GEGQQHHLGGAKQAGDV
Download sequence
Identical sequences G3R8D4
ENSGGOP00000011638 ENSGGOP00000011638 XP_004040582.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]