SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011683 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011683
Domain Number 1 Region: 222-461
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.8e-70
Family Nuclear receptor ligand-binding domain 0.000000000375
Further Details:      
 
Domain Number 2 Region: 18-103
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.96e-31
Family Nuclear receptor 0.0000979
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011683   Gene: ENSGGOG00000011970   Transcript: ENSGGOT00000012021
Sequence length 470
Comment pep:novel chromosome:gorGor3.1:9:56245582:56317527:1 gene:ENSGGOG00000011970 transcript:ENSGGOT00000012021 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCENQLKTKADATAQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQNNASYSCPRQ
RNCLIDRTNRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLYAEVQKHQQRLQEQRQ
QQSGEAEALARVYSSSISNGLSNLNNETSGTYANGHVIDLPKSEGYYNVDSGQPSPDQSG
LDMTGIKQIKQEPIYDLTSVPNLFTYSSFNNGQLAPGITMTEIDRIAQNIIKSHLETCQY
TMEELHQLAWQTHTYEEIKAYQSKSREALWQQCAIQITHAIQYVVEFAKRITGFMELCQN
DQILLLKSGCLEVVLVRMCRAFNPLNNTVLFEGKYGGMQMFKALGSDDLVNEAFDFAKNL
CSLQLTEEEIALFSSAVLISPDRAWLIEPRKVQKLQEKIYFALQHVIQKNHLDDETLAKL
IAKIPTITAVCNLHGEKLQVFKQSHPEIVNTLFPPLYKELFNPDCATGCK
Download sequence
Identical sequences A0A1L4FMK7 A0A2I2Z4J0 A0A2I3MFE2 A0A2K5JIH9 A0A2K5ZNM2 A0A2K6DSR4 A0A2K6MF89 A0A2K6T5Y1 F7GZT4 G7PSJ8 Q92753
ENSGGOP00000011683 ENSPTRP00000060490 ENSPTRP00000060490 ENSGGOP00000011683 ENSP00000379507 ENSP00000379507 ENSP00000379507 XP_011802414.1.43180 XP_011823640.1.47321 XP_017711273.1.44346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]