SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012314 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000012314
Domain Number - Region: 80-159
Classification Level Classification E-value
Superfamily a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.024
Family a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012314   Gene: ENSGGOG00000012632   Transcript: ENSGGOT00000012671
Sequence length 184
Comment pep:novel chromosome:gorGor3.1:3:33373261:33396447:-1 gene:ENSGGOG00000012632 transcript:ENSGGOT00000012671 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AMENGAVYSPTTEEDPGPARGPRSGLAAYFFMGRLPLLRRVLKGLQLLLSLLAFICEEVV
SQCTLCGGLYFFEFVSCSAFLLSLLILIVYCTPFYERVDTTKVKSSDFYITLGTGCVFLL
ASIIFVSTHDRTSAEIAAIVFGFIASFMFLLDFFTMLYEKRQESQLRKPENTTRAEALTE
PLNA
Download sequence
Identical sequences ENSGGOP00000012314 ENSGGOP00000012314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]