SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012351 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012351
Domain Number 1 Region: 584-771
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.88e-46
Family cAMP-binding domain 0.00047
Further Details:      
 
Domain Number 2 Region: 314-489,519-580
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.7e-43
Family Voltage-gated potassium channels 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012351   Gene: ENSGGOG00000012648   Transcript: ENSGGOT00000012708
Sequence length 1107
Comment pep:novel chromosome:gorGor3.1:2b:50019554:50187245:-1 gene:ENSGGOG00000012648 transcript:ENSGGOT00000012708 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TEKKRITVTYYQLSWSTFICNTHIIPVKNQEGVAMMFIINFEYVTDNENAATPERVNPIL
PIKTVNRKFFGFKFPGLRVLTYRKQSLPQEDPDVVVIDSSKHSDDSVAMKHFKSPTKESC
SPSEADDTKALIQPSKCSPLVNISGPLDHSSPKRQWDRLYPDMLQSSSQLSHSRSRESLC
SIRRASSVHDIEGFGVHPKNIFRDRHASEDNGRNVKGPFNHIKSSLLGSTSDSNLNKYST
INKIPQLTLNFSEAKTEKKNSSPPSSDKTIIAPKVKDRTHNVTEKVTQVLSLGADVLPEY
KLQTPRINKFTILHYSPFKAVWDWLILLLVIYTAIFTPYSAAFLLNDREEQKRRECGYSC
SPLNVVDLIVDIMFIIDILINFRTTYVNQNEEVVSDPAKIAIHYFKGWFLIDMVAAIPFD
LLIFGSGSDETTTLIGLLKTARLLRLVRVARKLDRYSEYGAAVLMLLMCIFALIAHWLAC
IWYAIGNVERPYLTDKIGWLDSLGQQIGKRYNDSDSSSGPSIKDKYVTALYFTFSSLTSV
GFGNVSPNTNSEKIFSICVMLIGSLMYASIFGNVSAIIQRLYSGTARYHMQMLRVKEFIR
FHQIPNPLRQRLEEYFQHAWTYTNGIDMNMVLKGFPECLQADICLHLNQTLLQNCKAFRG
ASKGCLRALAMKFKTTHAPPGDTLVHCGDVLTALYFLSRGSIEILKDDIVVAILGKNDIF
GEMVHLYAKPGKSNADVRALTYCDLHKIQREDLLEVLDMYPEFSDHFLTNLELTFNLRHE
SAKSQSMNDSEGDNCKLRRRKLSFESEGEKDFGKENSTNDPEDSADTIRHYQSSKRHFEE
KKSRSSSFISSIDDEQKPLFSGIVDSSPGIGKASGLDFEETVPTSGRVHIDKRSHSCKDI
TDMRSWERENALPQPEDSSPSALQRAAWGISETESDLTYGEVEQRLDLLQEQLNRLESQM
TTDIQTILQLLQKQTTVVPPAYSMVTAGAEYQRPIIQLMRTSQPEASIKTDRSFSPSSQC
PEFLDLEKSKLKSKESLSSGVHLNTASEDNLTSLLKQDSDLSLELHLRQRKTYIHPIRHP
SLPDSSLSTVGIVGLHRHVSDPGLPGK
Download sequence
Identical sequences ENSGGOP00000012351 ENSGGOP00000012351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]